Recombinant Human SERPINF1, Tag Free
Cat.No. : | SERPINF1-062S |
Product Overview : | Recombinant Human SERPINF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 20-418 a.a. |
Description : | PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is a 50 kDa glycoprotein produced and secreted in many tissues throughout the body. A major component of the anti-angiogenic action of PEDF is the induction of apoptosis in proliferating endothelial cells. In addition, PEDF is able to inhibit the activity of angiogenic factors such as VEGF and FGF-2. The neuroprotective effects of PEDF are achieved through suppression of neuronal apoptosis induced by peroxide, glutamate, or other neurotoxins. The recent identification of a lipase-linked cell membrane receptor for PEDF (PEDF-R) that binds to PEDF with high affinity should facilitate further elucidation of the underlying mechanisms of this pluripotent serpin. To date, PEDF-R is the only signaling receptor known to be used by a serpin family member. The unique range of PEDF activities implicate it as a potential therapeutic agent for the treatment of vasculature related neurodegenerative diseases such as age-related macular degeneration (AMD) and proliferative diabetic retinopathy (PDR). PEDF also has the potential to be useful in the treatment of various angiogenesis-related diseases including a number of cancers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data Not Available. |
Molecular Mass : | Approximately 44.5 KDa, a single non-glycosylated polypeptide chain containing 400 amino acids. |
AA Sequence : | MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
Endotoxin : | Less than 1 EU/mg of rHuPEDF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SERPINF1 serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 [ Homo sapiens ] |
Official Symbol | SERPINF1 |
Synonyms | SERPINF1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; PEDF, serine (or cysteine) proteinase inhibitor, clade F (alpha 2 antiplasmin, pigment epithelium derived factor), member 1; pigment epithelium-derived factor; EPC 1; PIG35; pigment epithelium derived factor; proliferation inducing protein 35; serpin F1; cell proliferation-inducing gene 35 protein; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; OI6; OI12; PEDF; EPC-1; |
Gene ID | 5176 |
mRNA Refseq | NM_002615 |
Protein Refseq | NP_002606 |
MIM | 172860 |
UniProt ID | P36955 |
◆ Recombinant Proteins | ||
SERPINF1-2567H | Recombinant Human SERPINF1 protein | +Inquiry |
Serpinf1-1652R | Recombinant Rat Serpinf1 protein, His & SUMO-tagged | +Inquiry |
SERPINF1-07H | Recombinant Human SERPINF1 protein | +Inquiry |
SERPINF1-1982H | Recombinant Human SERPINF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINF1-378H | Active Recombinant Full Length Human SERPINF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
SERPINF1-2673MCL | Recombinant Mouse SERPINF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINF1 Products
Required fields are marked with *
My Review for All SERPINF1 Products
Required fields are marked with *
0
Inquiry Basket