Recombinant Human SF3A3, His-tagged
Cat.No. : | SF3A3-30078TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 97-501 of Human SF3A3 with N terminal His tag; 405 amino acids, 54kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 97-501 a.a. |
Description : | This gene encodes subunit 3 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 3 interacts with subunit 1 through its amino-terminus while the zinc finger domain of subunit 3 plays a role in its binding to the 15S U2 snRNP. This gene has a pseudogene on chromosome 20. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 149 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGY GRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIP KERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQ AEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSW EELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKG KSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEY VEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESE SEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNC EICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHF ANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSG NVVNKKTYEDLKRQGLL |
Gene Name | SF3A3 splicing factor 3a, subunit 3, 60kDa [ Homo sapiens ] |
Official Symbol | SF3A3 |
Synonyms | SF3A3; splicing factor 3a, subunit 3, 60kDa; splicing factor 3a, subunit 3, 60kD; splicing factor 3A subunit 3; PRP9; PRPF9; SAP61; SF3a60; |
Gene ID | 10946 |
mRNA Refseq | NM_006802 |
Protein Refseq | NP_006793 |
MIM | 605596 |
Uniprot ID | Q12874 |
Chromosome Location | 1p |
Pathway | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Spliceosome, organism-specific biosystem; |
Function | metal ion binding; nucleic acid binding; zinc ion binding; |
◆ Recombinant Proteins | ||
SF3A3-2612H | Recombinant Human SF3A3, GST-tagged | +Inquiry |
SF3A3-6161H | Recombinant Human SF3A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SF3A3-1235Z | Recombinant Zebrafish SF3A3 | +Inquiry |
SF3A3-30078TH | Recombinant Human SF3A3, His-tagged | +Inquiry |
Sf3a3-5809M | Recombinant Mouse Sf3a3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF3A3-1919HCL | Recombinant Human SF3A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SF3A3 Products
Required fields are marked with *
My Review for All SF3A3 Products
Required fields are marked with *