Recombinant Human SFN, His-tagged

Cat.No. : SFN-26015TH
Product Overview : Recombinant Full Length Human 14-3-3 sigma expressed in Saccharomyces cerevisiae; amino acids 1-248; 248 amino acids, 27.7 kDa. This protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : His
Protein Length : 1-248 a.a.
Description : 14-3-3 protein sigma is a protein that in humans is encoded by the SFN gene.
Conjugation : HIS
Tissue specificity : Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEE RNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLA KTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Sequence Similarities : Belongs to the 14-3-3 family.
Full Length : Full L.
Gene Name SFN stratifin [ Homo sapiens ]
Official Symbol SFN
Synonyms SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS;
Gene ID 2810
mRNA Refseq NM_006142
Protein Refseq NP_006133
MIM 601290
Uniprot ID P31947
Chromosome Location 1p36.11
Pathway Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem;
Function phosphoprotein binding; protein binding; protein domain specific binding; protein kinase C inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFN Products

Required fields are marked with *

My Review for All SFN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon