Recombinant Human SFN protein(1-248aa), His&Myc-tagged
| Cat.No. : | SFN-4644H |
| Product Overview : | Recombinant Human SFN protein(P31947)(1-248aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-248aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Gene Name | SFN stratifin [ Homo sapiens ] |
| Official Symbol | SFN |
| Synonyms | SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS; 14-3-3 sigma; epithelial cell marker protein 1; |
| Gene ID | 2810 |
| mRNA Refseq | NM_006142 |
| Protein Refseq | NP_006133 |
| MIM | 601290 |
| UniProt ID | P31947 |
| ◆ Recombinant Proteins | ||
| SFN-942HFL | Recombinant Full Length Human SFN Protein, C-Flag-tagged | +Inquiry |
| SFN-3857H | Recombinant Human SFN protein, GST-tagged | +Inquiry |
| SFN-008H | Recombinant Human SFN Protein, His-tagged | +Inquiry |
| Sfn-5813M | Recombinant Mouse Sfn Protein, Myc/DDK-tagged | +Inquiry |
| SFN-3989R | Recombinant Rhesus Macaque SFN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SFN-1912HCL | Recombinant Human SFN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFN Products
Required fields are marked with *
My Review for All SFN Products
Required fields are marked with *
