Recombinant Human SGCA

Cat.No. : SGCA-27337TH
Product Overview : Recombinant fragment of Human alpha Sarcoglycan with an N terminal proprietary tag. Predicted MW 37.51kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.510kDa inclusive of tags
Tissue specificity : Most strongly expressed in skeletal muscle. Also expressed in cardiac muscle and, at much lower levels, in lung. In the fetus, most abundant in cardiac muscle and, at lower levels, in lung. Also detected in liver and kidney. Not expressed in brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAH LQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEV TAYNRDSFDTTRQRLVLEIGDPEGPLLP
Sequence Similarities : Belongs to the sarcoglycan alpha/epsilon family.
Gene Name SGCA sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
Official Symbol SGCA
Synonyms SGCA; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); ADL, sarcoglycan, alpha (50kD dystrophin associated glycoprotein); alpha-sarcoglycan; 50kD DAG; A2; adhalin; adhalin (limb girdle muscular dystrophy 2D); DMDA2; LGMD2D; Sarcoglycan; alp
Gene ID 6442
mRNA Refseq NM_001135697
Protein Refseq NP_001129169
MIM 600119
Uniprot ID Q16586
Chromosome Location 17q21
Pathway Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SGCA Products

Required fields are marked with *

My Review for All SGCA Products

Required fields are marked with *

0
cart-icon
0
compare icon