Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SGCA

Cat.No. : SGCA-27337TH
Product Overview : Recombinant fragment of Human alpha Sarcoglycan with an N terminal proprietary tag. Predicted MW 37.51kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 108 amino acids
Molecular Weight : 37.510kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Most strongly expressed in skeletal muscle. Also expressed in cardiac muscle and, at much lower levels, in lung. In the fetus, most abundant in cardiac muscle and, at lower levels, in lung. Also detected in liver and kidney. Not expressed in brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAH LQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEV TAYNRDSFDTTRQRLVLEIGDPEGPLLP
Sequence Similarities : Belongs to the sarcoglycan alpha/epsilon family.
Gene Name : SGCA sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
Official Symbol : SGCA
Synonyms : SGCA; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); ADL, sarcoglycan, alpha (50kD dystrophin associated glycoprotein); alpha-sarcoglycan; 50kD DAG; A2; adhalin; adhalin (limb girdle muscular dystrophy 2D); DMDA2; LGMD2D; Sarcoglycan; alp
Gene ID : 6442
mRNA Refseq : NM_001135697
Protein Refseq : NP_001129169
MIM : 600119
Uniprot ID : Q16586
Chromosome Location : 17q21
Pathway : Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;
Function : calcium ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends