Recombinant Human SGCA
Cat.No. : | SGCA-27337TH |
Product Overview : | Recombinant fragment of Human alpha Sarcoglycan with an N terminal proprietary tag. Predicted MW 37.51kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 108 amino acids |
Description : | This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.510kDa inclusive of tags |
Tissue specificity : | Most strongly expressed in skeletal muscle. Also expressed in cardiac muscle and, at much lower levels, in lung. In the fetus, most abundant in cardiac muscle and, at lower levels, in lung. Also detected in liver and kidney. Not expressed in brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAH LQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEV TAYNRDSFDTTRQRLVLEIGDPEGPLLP |
Sequence Similarities : | Belongs to the sarcoglycan alpha/epsilon family. |
Gene Name | SGCA sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
Official Symbol | SGCA |
Synonyms | SGCA; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); ADL, sarcoglycan, alpha (50kD dystrophin associated glycoprotein); alpha-sarcoglycan; 50kD DAG; A2; adhalin; adhalin (limb girdle muscular dystrophy 2D); DMDA2; LGMD2D; Sarcoglycan; alp |
Gene ID | 6442 |
mRNA Refseq | NM_001135697 |
Protein Refseq | NP_001129169 |
MIM | 600119 |
Uniprot ID | Q16586 |
Chromosome Location | 17q21 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
SGCA-27337TH | Recombinant Human SGCA | +Inquiry |
SGCA-01H | Recombinant Human SGCA Protein, Myc/DDK-tagged | +Inquiry |
SGCA-3498H | Recombinant Human SGCA protein, His-tagged | +Inquiry |
SGCA-8095M | Recombinant Mouse SGCA Protein, His (Fc)-Avi-tagged | +Inquiry |
SGCA-02H | Recombinant Human SGCA Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCA-1890HCL | Recombinant Human SGCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGCA Products
Required fields are marked with *
My Review for All SGCA Products
Required fields are marked with *
0
Inquiry Basket