Recombinant Human SGCA protein, His-tagged
| Cat.No. : | SGCA-3498H |
| Product Overview : | Recombinant Human SGCA protein(24-105 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-105 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SGCA sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
| Official Symbol | SGCA |
| Synonyms | SGCA; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); ADL, sarcoglycan, alpha (50kD dystrophin associated glycoprotein); alpha-sarcoglycan; 50kD DAG; A2; adhalin; adhalin (limb girdle muscular dystrophy 2D); DMDA2; LGMD2D; Sarcoglycan; alpha (50kD dystrophin associated glycoprotein; adhalin); SCARMD1; 50DAG; alpha-SG; dystroglycan-2; 50 kDa dystrophin-associated glycoprotein; ADL; DAG2; 50-DAG; |
| Gene ID | 6442 |
| mRNA Refseq | NM_000023 |
| Protein Refseq | NP_000014 |
| MIM | 600119 |
| UniProt ID | Q16586 |
| ◆ Recombinant Proteins | ||
| SGCA-3498H | Recombinant Human SGCA protein, His-tagged | +Inquiry |
| SGCA-01H | Recombinant Human SGCA Protein, Myc/DDK-tagged | +Inquiry |
| SGCA-1994H | Recombinant Human SGCA Protein, His (Fc)-Avi-tagged | +Inquiry |
| SGCA-8095M | Recombinant Mouse SGCA Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL18226MF | Recombinant Full Length Mouse Alpha-Sarcoglycan(Sgca) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SGCA-1890HCL | Recombinant Human SGCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGCA Products
Required fields are marked with *
My Review for All SGCA Products
Required fields are marked with *
