Recombinant Human SGCA protein, His-tagged
Cat.No. : | SGCA-3498H |
Product Overview : | Recombinant Human SGCA protein(24-105 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-105 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SGCA sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
Official Symbol | SGCA |
Synonyms | SGCA; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); ADL, sarcoglycan, alpha (50kD dystrophin associated glycoprotein); alpha-sarcoglycan; 50kD DAG; A2; adhalin; adhalin (limb girdle muscular dystrophy 2D); DMDA2; LGMD2D; Sarcoglycan; alpha (50kD dystrophin associated glycoprotein; adhalin); SCARMD1; 50DAG; alpha-SG; dystroglycan-2; 50 kDa dystrophin-associated glycoprotein; ADL; DAG2; 50-DAG; |
Gene ID | 6442 |
mRNA Refseq | NM_000023 |
Protein Refseq | NP_000014 |
MIM | 600119 |
UniProt ID | Q16586 |
◆ Recombinant Proteins | ||
SGCA-15028M | Recombinant Mouse SGCA Protein | +Inquiry |
SGCA-02H | Recombinant Human SGCA Protein, Myc/DDK-tagged | +Inquiry |
SGCA-1669H | Recombinant Human SGCA protein, His & GST-tagged | +Inquiry |
SGCA-1994H | Recombinant Human SGCA Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18226MF | Recombinant Full Length Mouse Alpha-Sarcoglycan(Sgca) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCA-1890HCL | Recombinant Human SGCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGCA Products
Required fields are marked with *
My Review for All SGCA Products
Required fields are marked with *