Recombinant Human SH2D1A protein, GST-tagged
Cat.No. : | SH2D1A-2639H |
Product Overview : | Recombinant Human SH2D1A protein(1-128 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-128 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SH2D1A |
Synonyms | SH2D1A; SH2 domain containing 1A; IMD5, lymphoproliferative syndrome , LYP, SH2 domain protein 1A; SH2 domain-containing protein 1A; DSHP; Duncans disease; EBVS; MTCP1; SAP; XLP; XLPD; SLAM-associated protein; Duncan disease SH2-protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; SLAM associated protein/SH2 domain protein 1A; signaling lymphocyte activation molecule-associated protein; signaling lymphocytic activation molecule-associated protein; LYP; IMD5; SAP/SH2D1A; FLJ18687; FLJ92177; |
Gene ID | 4068 |
mRNA Refseq | NM_001114937 |
Protein Refseq | NP_001108409 |
MIM | 300490 |
UniProt ID | O60880 |
◆ Recombinant Proteins | ||
SH2D1A-22H | Recombinant Human SH2D1A Protein, MYC/DDK-tagged | +Inquiry |
SH2D1A-8116M | Recombinant Mouse SH2D1A Protein, His (Fc)-Avi-tagged | +Inquiry |
SH2D1A-4591H | Recombinant Human SH2 Domain Containing 1A, His-tagged | +Inquiry |
SH2D1A-3239H | Recombinant Human SH2D1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH2D1A-4185R | Recombinant Rhesus monkey SH2D1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH2D1A-1879HCL | Recombinant Human SH2D1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH2D1A Products
Required fields are marked with *
My Review for All SH2D1A Products
Required fields are marked with *