Recombinant Human SH2D1A protein, GST-tagged

Cat.No. : SH2D1A-2639H
Product Overview : Recombinant Human SH2D1A protein(1-128 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability September 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-128 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SH2D1A
Synonyms SH2D1A; SH2 domain containing 1A; IMD5, lymphoproliferative syndrome , LYP, SH2 domain protein 1A; SH2 domain-containing protein 1A; DSHP; Duncans disease; EBVS; MTCP1; SAP; XLP; XLPD; SLAM-associated protein; Duncan disease SH2-protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; SLAM associated protein/SH2 domain protein 1A; signaling lymphocyte activation molecule-associated protein; signaling lymphocytic activation molecule-associated protein; LYP; IMD5; SAP/SH2D1A; FLJ18687; FLJ92177;
Gene ID 4068
mRNA Refseq NM_001114937
Protein Refseq NP_001108409
MIM 300490
UniProt ID O60880

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH2D1A Products

Required fields are marked with *

My Review for All SH2D1A Products

Required fields are marked with *

0
cart-icon
0
compare icon