Recombinant Human SH2D1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SH2D1A-3239H |
Product Overview : | SH2D1A MS Standard C13 and N15-labeled recombinant protein (NP_002342) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SH2D1A SH2 domain containing 1A [ Homo sapiens (human) ] |
Official Symbol | SH2D1A |
Synonyms | SH2D1A; SH2 domain containing 1A; IMD5, lymphoproliferative syndrome, LYP, SH2 domain protein 1A; SH2 domain-containing protein 1A; DSHP; Duncans disease; EBVS; MTCP1; SAP; XLP; XLPD; SLAM-associated protein; Duncan disease SH2-protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; SLAM associated protein/SH2 domain protein 1A; signaling lymphocyte activation molecule-associated protein; signaling lymphocytic activation molecule-associated protein; LYP; IMD5; SAP/SH2D1A; FLJ18687; FLJ92177; |
Gene ID | 4068 |
mRNA Refseq | NM_002351 |
Protein Refseq | NP_002342 |
MIM | 300490 |
UniProt ID | O60880 |
◆ Recombinant Proteins | ||
Sh2d1a-1500M | Recombinant Mouse Sh2d1a protein, His & T7-tagged | +Inquiry |
SH2D1A-4591H | Recombinant Human SH2 Domain Containing 1A, His-tagged | +Inquiry |
SH2D1A-7029H | Active Recombinant Human SH2D1A protein, His-tagged | +Inquiry |
SH2D1A-15054M | Recombinant Mouse SH2D1A Protein | +Inquiry |
SH2D1A-5863H | Recombinant Human SH2D1A Protein (Met1-Pro128), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH2D1A-1879HCL | Recombinant Human SH2D1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH2D1A Products
Required fields are marked with *
My Review for All SH2D1A Products
Required fields are marked with *
0
Inquiry Basket