Recombinant Human SH3BP2 protein, His-tagged
Cat.No. : | SH3BP2-4533H |
Product Overview : | Recombinant Human SH3BP2 protein(401-561 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 401-561 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR |
Gene Name | SH3BP2 SH3-domain binding protein 2 [ Homo sapiens ] |
Official Symbol | SH3BP2 |
Synonyms | SH3BP2; SH3-domain binding protein 2; Cherubism; SH3 domain-binding protein 2; CRBM; RES4 23; Abl-SH3 binding protein 2; TNFAIP3 interacting protein 2; 3BP2; CRPM; 3BP-2; RES4-23; FLJ42079; FLJ54978; |
Gene ID | 6452 |
mRNA Refseq | NM_001122681 |
Protein Refseq | NP_001116153 |
MIM | 602104 |
UniProt ID | P78314 |
◆ Recombinant Proteins | ||
SH3BP2-6280H | Recombinant Human SH3BP2 Protein (Met1-Leu259), N-His tagged | +Inquiry |
SH3BP2-2833C | Recombinant Chicken SH3BP2 | +Inquiry |
SH3BP2-708H | Recombinant Human SH3BP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sh3bp2-5841M | Recombinant Mouse Sh3bp2 Protein, Myc/DDK-tagged | +Inquiry |
SH3BP2-9178H | Recombinant Human SH3BP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3BP2-1871HCL | Recombinant Human SH3BP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH3BP2 Products
Required fields are marked with *
My Review for All SH3BP2 Products
Required fields are marked with *
0
Inquiry Basket