Recombinant Human SH3BP2 protein, His-tagged

• Cat.No.: SH3BP2-4533H
• Product Overview: Recombinant Human SH3BP2 protein(401-561 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 401-561 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: VLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR

Gene Information

• Gene Name: SH3BP2 SH3-domain binding protein 2 [ Homo sapiens ]
• Official Symbol: SH3BP2
• Synonyms: SH3BP2; SH3-domain binding protein 2; Cherubism; SH3 domain-binding protein 2; CRBM; RES4 23; Abl-SH3 binding protein 2; TNFAIP3 interacting protein 2; 3BP2; CRPM; 3BP-2; RES4-23; FLJ42079; FLJ54978
• Gene ID: 6452
• mRNA Refseq: NM_001122681
• Protein Refseq: NP_001116153
• MIM: 602104
• UniProt ID: P78314