Recombinant Human SHC1 protein, His-tagged

• Cat.No.: SHC1-2444H
• Product Overview: Recombinant Human SHC1 protein(1-169 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-169 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SHC1 SHC (Src homology 2 domain containing) transforming protein 1 [ Homo sapiens ]
• Official Symbol: SHC1
• Synonyms: SHC1; SHC (Src homology 2 domain containing) transforming protein 1; SHC, SHC (Src homology 2 domain containing) transforming protein 1; SHC-transforming protein 1; p66; SH2 domain protein C1; SHC-transforming protein 3; SHC-transforming protein A; SHC (Src homology 2 domain-containing) transforming protein 1; SHC; SHCA; FLJ26504
• Gene ID: 6464
• mRNA Refseq: NM_001130040
• Protein Refseq: NP_001123512
• MIM: 600560
• UniProt ID: P29353