Recombinant Human SHH protein, His-tagged
| Cat.No. : | SHH-3963H |
| Product Overview : | Recombinant Human SHH protein(23-197 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-197 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SHH sonic hedgehog [ Homo sapiens ] |
| Official Symbol | SHH |
| Synonyms | SHH; sonic hedgehog; HLP3, HPE3, sonic hedgehog (Drosophila) homolog , sonic hedgehog homolog (Drosophila); sonic hedgehog protein; HHG1; MCOPCB5; SMMCI; TPT; TPTPS; sonic hedgehog homolog; HLP3; HPE3; |
| Gene ID | 6469 |
| mRNA Refseq | NM_000193 |
| Protein Refseq | NP_000184 |
| MIM | 600725 |
| UniProt ID | Q15465 |
| ◆ Recombinant Proteins | ||
| SHH-7285H | Active Recombinant Human SHH protein(Met1-Gly197), His-tagged | +Inquiry |
| SHH-1229H | Recombinant Human SHH Protein, His-tagged | +Inquiry |
| Shh-7339M | Recombinant Mouse Shh Protein, His-tagged | +Inquiry |
| SHH-6284H | Recombinant Human SHH Protein (Cys24-Gly197) | +Inquiry |
| SHH-1250M | Acitve Recombinant Mouse SHH protein(Met1-Gly198), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
| SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
| SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHH Products
Required fields are marked with *
My Review for All SHH Products
Required fields are marked with *
