Recombinant Human SHH protein, His-tagged
Cat.No. : | SHH-3963H |
Product Overview : | Recombinant Human SHH protein(23-197 aa), fused to His tag, was expressed in E. coli. |
Availability | July 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-197 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SHH sonic hedgehog [ Homo sapiens ] |
Official Symbol | SHH |
Synonyms | SHH; sonic hedgehog; HLP3, HPE3, sonic hedgehog (Drosophila) homolog , sonic hedgehog homolog (Drosophila); sonic hedgehog protein; HHG1; MCOPCB5; SMMCI; TPT; TPTPS; sonic hedgehog homolog; HLP3; HPE3; |
Gene ID | 6469 |
mRNA Refseq | NM_000193 |
Protein Refseq | NP_000184 |
MIM | 600725 |
UniProt ID | Q15465 |
◆ Recombinant Proteins | ||
Shh-5863M | Recombinant Mouse Shh Protein, Myc/DDK-tagged | +Inquiry |
Shh-8701M | Recombinant Mouse Shh protein, His-tagged | +Inquiry |
SHH-852M | Recombinant Mouse SHH Protein (Ile24-Gly198), His-tagged | +Inquiry |
SHH-3963H | Recombinant Human SHH protein, His-tagged | +Inquiry |
Shh-1856R | Recombinant Rat Shh protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHH Products
Required fields are marked with *
My Review for All SHH Products
Required fields are marked with *