Recombinant Human SIGIRR, Fc-tagged, Biotinylated
Cat.No. : | SIGIRR-674H |
Product Overview : | The recombinant human SIGIRR ECD is expressed as a 357 amino acid protein consisting of Met1 -His118 region of SIGIRR (UniProt accession #Q6IA17) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 1-118 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Molecular Mass : | Calculated molecular mass (kDa): 39.3; Estimated by SDS-PAGE under reducing condition (kDa): ~55 (probably due to glycosylation). |
AA Sequence : | MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANL SEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHGSTTENLYFQGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ] |
Official Symbol | SIGIRR |
Synonyms | SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992; |
Gene ID | 59307 |
mRNA Refseq | NM_001135053 |
Protein Refseq | NP_001128525 |
MIM | 605478 |
UniProt ID | Q6IA17 |
Chromosome Location | 11p15.5 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem; Toll Like Receptor 4 (TLR4) Cascade, organism-specific biosystem; Toll Like Receptor TLR1:TLR2 Cascade, organism-specific biosystem; |
Function | protein binding; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
SIGIRR-6152H | Recombinant Human SIGIRR Protein (Met1-His118), His tagged | +Inquiry |
SIGIRR-28784TH | Recombinant Human SIGIRR protein, Fc-tagged | +Inquiry |
SIGIRR-5059R | Recombinant Rat SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGIRR-28785TH | Recombinant Human SIGIRR, His-tagged | +Inquiry |
SIGIRR-5670Z | Recombinant Zebrafish SIGIRR | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *
0
Inquiry Basket