Recombinant Human SIGLEC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SIGLEC1-838H
• Product Overview: SIGLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_075556) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a lectin-like adhesion molecule that binds glycoconjugate ligands on cell surfaces in a sialic acid-dependent manner. It is a type I transmembrane protein expressed only by a subpopulation of macrophages and is involved in mediating cell-cell interactions. Alternative splicing produces a transcript variant encoding an isoform that is soluble rather than membrane-bound; however, the full-length nature of this variant has not been determined.
• Molecular Mass: 180.6 kDa
• AA Sequence: MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SIGLEC1 sialic acid binding Ig like lectin 1 [ Homo sapiens (human) ]
• Official Symbol: SIGLEC1
• Synonyms: SIGLEC1; sialic acid binding Ig-like lectin 1, sialoadhesin; sialoadhesin, SN; sialoadhesin; CD169; dJ1009E24.1; FLJ00051; FLJ00055; FLJ00073; FLJ32150; SIGLEC 1; sialic acid-binding Ig-like lectin 1; sialic acid-binding immunoglobulin-like lectin 1; SN; SIGLEC-1; FLJ00411; DKFZp667F058
• Gene ID: 6614
• mRNA Refseq: NM_023068
• Protein Refseq: NP_075556
• MIM: 600751
• UniProt ID: Q9BZZ2