Recombinant Human SIGLEC6, His-tagged
| Cat.No. : | SIGLEC6-59H |
| Product Overview : | Recombinant Human Sialic Acid-Binding Ig-Like Lectin 6/SIGLEC6 produced by transfected human cells is a secreted protein with sequence (Gln27-Val347) of Human siglec-6/CD327 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 27-347 a.a. |
| Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : | QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRG RFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTL ESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPG AGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG VLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens ] |
| Official Symbol | SIGLEC6 |
| Synonyms | SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327; |
| Gene ID | 946 |
| mRNA Refseq | NM_001177547 |
| Protein Refseq | NP_001171018 |
| MIM | 604405 |
| UniProt ID | O43699 |
| Chromosome Location | 19q13.3 |
| Function | sugar binding; |
| ◆ Recombinant Proteins | ||
| SIGLEC6-1743R | Recombinant Rhesus Monkey SIGLEC6 Protein | +Inquiry |
| RFL6654HF | Recombinant Full Length Human Sialic Acid-Binding Ig-Like Lectin 6(Siglec6) Protein, His-Tagged | +Inquiry |
| SIGLEC6-446H | Recombinant Human SIGLEC6 Protein, Fc-tagged | +Inquiry |
| SIGLEC6-339H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
| SIGLEC6-55H | Recombinant Human SIGLEC6 Protein, Fc-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGLEC6-795HCL | Recombinant Human SIGLEC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLEC6 Products
Required fields are marked with *
My Review for All SIGLEC6 Products
Required fields are marked with *
