"SIGMAR1" Related Products

Expand
Expand

Recombinant Human SIGMAR1 protein, GST-tagged

Cat.No.: SIGMAR1-13H
Product Overview: Recombinant Human SIGMAR1(1 a.a. - 223 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 51.5 kDa
AA Sequence: MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLP DEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SIGMAR1 sigma non-opioid intracellular receptor 1 [ Homo sapiens ]
Official Symbol: SIGMAR1
Synonyms: SIGMAR1; sigma non-opioid intracellular receptor 1; opioid receptor, sigma 1 , OPRS1; SR BP1; SR-BP; SIG-1R; sigma1R; hSigmaR1; SR31747 binding protein 1; sigma 1-type opioid receptor; aging-associated gene 8 protein; SRBP; ALS16; OPRS1; SR-BP1; MGC3851; FLJ25585;
Gene ID: 10280
mRNA Refseq: NM_005866
Protein Refseq: NP_005857
MIM: 601978
UniProt ID: Q99720
Chromosome Location: 9p13.3
Function: C-8 sterol isomerase activity; drug binding; opioid receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.