Recombinant Human SIGMAR1 protein, GST-tagged
| Cat.No. : | SIGMAR1-13H |
| Product Overview : | Recombinant Human SIGMAR1(1 a.a. - 223 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-223 a.a. |
| Description : | This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLP DEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SIGMAR1 sigma non-opioid intracellular receptor 1 [ Homo sapiens ] |
| Official Symbol | SIGMAR1 |
| Synonyms | SIGMAR1; sigma non-opioid intracellular receptor 1; opioid receptor, sigma 1 , OPRS1; SR BP1; SR-BP; SIG-1R; sigma1R; hSigmaR1; SR31747 binding protein 1; sigma 1-type opioid receptor; aging-associated gene 8 protein; SRBP; ALS16; OPRS1; SR-BP1; MGC3851; FLJ25585; |
| Gene ID | 10280 |
| mRNA Refseq | NM_005866 |
| Protein Refseq | NP_005857 |
| MIM | 601978 |
| UniProt ID | Q99720 |
| Chromosome Location | 9p13.3 |
| Function | C-8 sterol isomerase activity; drug binding; opioid receptor activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| SIGMAR1-4646C | Recombinant Chicken SIGMAR1 | +Inquiry |
| SIGMAR1-2473HFL | Recombinant Full Length Human SIGMAR1 protein, Flag-tagged | +Inquiry |
| SIGMAR1-5128H | Recombinant Human SIGMAR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SIGMAR1-5060R | Recombinant Rat SIGMAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SIGMAR1-629HF | Recombinant Full Length Human SIGMAR1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGMAR1-1843HCL | Recombinant Human SIGMAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGMAR1 Products
Required fields are marked with *
My Review for All SIGMAR1 Products
Required fields are marked with *
