Recombinant Human SIGMAR1 protein, GST-tagged

Cat.No. : SIGMAR1-13H
Product Overview : Recombinant Human SIGMAR1(1 a.a. - 223 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-223 a.a.
Description : This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.5 kDa
AA Sequence : MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLP DEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SIGMAR1 sigma non-opioid intracellular receptor 1 [ Homo sapiens ]
Official Symbol SIGMAR1
Synonyms SIGMAR1; sigma non-opioid intracellular receptor 1; opioid receptor, sigma 1 , OPRS1; SR BP1; SR-BP; SIG-1R; sigma1R; hSigmaR1; SR31747 binding protein 1; sigma 1-type opioid receptor; aging-associated gene 8 protein; SRBP; ALS16; OPRS1; SR-BP1; MGC3851; FLJ25585;
Gene ID 10280
mRNA Refseq NM_005866
Protein Refseq NP_005857
MIM 601978
UniProt ID Q99720
Chromosome Location 9p13.3
Function C-8 sterol isomerase activity; drug binding; opioid receptor activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGMAR1 Products

Required fields are marked with *

My Review for All SIGMAR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon