Recombinant Human SIKE1 protein, GST-tagged
Cat.No. : | SIKE1-30168H |
Product Overview : | Recombinant Human SIKE1 protein(108-207 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 108-207 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | YRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SIKE1 suppressor of IKBKE 1 [ Homo sapiens ] |
Official Symbol | SIKE1 |
Synonyms | SIKE; RP5-1000E10.4 |
Gene ID | 80143 |
mRNA Refseq | NM_025073.2 |
Protein Refseq | NP_079349.2 |
MIM | 611656 |
UniProt ID | Q9BRV8 |
◆ Recombinant Proteins | ||
SIKE1-5122H | Recombinant Human SIKE1, His-tagged | +Inquiry |
SIKE1-4204R | Recombinant Rhesus monkey SIKE1 Protein, His-tagged | +Inquiry |
SIKE1-2673H | Recombinant Human SIKE1, His-tagged | +Inquiry |
SIKE1-2977H | Recombinant Human SIKE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SIKE1-8173M | Recombinant Mouse SIKE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIKE1-1840HCL | Recombinant Human SIKE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIKE1 Products
Required fields are marked with *
My Review for All SIKE1 Products
Required fields are marked with *