Recombinant Human SIKE1 protein, GST-tagged
| Cat.No. : | SIKE1-30168H |
| Product Overview : | Recombinant Human SIKE1 protein(108-207 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 108-207 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | YRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SIKE1 suppressor of IKBKE 1 [ Homo sapiens ] |
| Official Symbol | SIKE1 |
| Synonyms | SIKE; RP5-1000E10.4 |
| Gene ID | 80143 |
| mRNA Refseq | NM_025073.2 |
| Protein Refseq | NP_079349.2 |
| MIM | 611656 |
| UniProt ID | Q9BRV8 |
| ◆ Recombinant Proteins | ||
| SIKE1-5122H | Recombinant Human SIKE1, His-tagged | +Inquiry |
| Sike1-5879M | Recombinant Mouse Sike1 Protein, Myc/DDK-tagged | +Inquiry |
| SIKE1-2977H | Recombinant Human SIKE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SIKE1-1469C | Recombinant Chicken SIKE1 | +Inquiry |
| SIKE1-521H | Recombinant Human suppressor of IKBKE 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIKE1-1840HCL | Recombinant Human SIKE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIKE1 Products
Required fields are marked with *
My Review for All SIKE1 Products
Required fields are marked with *
