Recombinant Human SIRPA protein, His-tagged
Cat.No. : | SIPRA-4843H |
Product Overview : | Recombinant Human SIRPA(Glu31-Arg370) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Glu31-Arg370 |
Description : | Signal Regulatory Protein α (SIRPα) is a monomeric approximately 90 kD type I transmembrane glycoprotein. The 504 amino acid human SIRPα contains two Ig-like C1-type domains and one Ig-like V-type domain. SIRPα can express in various tissues, mainly on brain and myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It also can detect in neurons, smooth muscle and endothelial cells. SIRPA is an immunoglobulin-like cell surface receptor for CD47. SIRPα acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. SIRPα shows adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. SIRPα engagement generally produces a negative regulatory signal; it may mediate negative regulation of phagocytosis, mast cell activation and dendritic cell activation. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
AA Sequence : | EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVSE STKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPAARAT PQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQV ICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENG NVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQ GSNTAAENTGSNERNVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | SIRPA signal-regulatory protein alpha [ Homo sapiens ] |
Official Symbol | SIRPA |
Synonyms | SIRPA; signal-regulatory protein alpha; protein tyrosine phosphatase, non receptor type substrate 1 , PTPNS1; tyrosine-protein phosphatase non-receptor type substrate 1; BIT; CD172a; MFR; MYD 1; P84; SHPS 1; SHPS1; SIRP; SIRP ALPHA 1; SIRPalpha; SIRPalpha2; myd-1 antigen; inhibitory receptor SHPS-1; macrophage fusion receptor; CD172 antigen-like family member A; tyrosine phosphatase SHP substrate 1; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; MYD-1; CD172A; PTPNS1; |
Gene ID | 140885 |
mRNA Refseq | NM_001040022 |
Protein Refseq | NP_001035111 |
MIM | 602461 |
UniProt ID | P78324 |
◆ Recombinant Proteins | ||
SIRPA-937M | Recombinant Mouse SIRPA protein, His-tagged | +Inquiry |
SIRPA-1389H | Acitve Recombinant Human SIRPA protein(Met1-Arg369(S44L, S50T, I52T, H54R, V57A)), mFc-tagged | +Inquiry |
SIRPA-0699H | Active Recombinant Human SIRPA protein, lFc-tagged | +Inquiry |
SIRPA-348M | Active Recombinant Mouse SIRPA protein, mFc-tagged | +Inquiry |
SIRPA-051H | Active Recombinant Human SIRPA protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRPA-2298HCL | Recombinant Human SIRPA cell lysate | +Inquiry |
SIRPA-1650MCL | Recombinant Mouse SIRPA cell lysate | +Inquiry |
SIRPA-1005RCL | Recombinant Rat SIRPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRPA Products
Required fields are marked with *
My Review for All SIRPA Products
Required fields are marked with *
0
Inquiry Basket