Recombinant Human SIRT1 protein, His-tagged
Cat.No. : | SIRT1-6323H |
Product Overview : | Recombinant Human SIRT1 protein(1-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SIRT1 sirtuin 1 [ Homo sapiens ] |
Official Symbol | SIRT1 |
Synonyms | SIRT1; sirtuin 1; sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 1; NAD-dependent deacetylase sirtuin-1; SIR2L1; hSIR2; hSIRT1; SIR2alpha; sir2-like 1; sirtuin type 1; SIR2-like protein 1; |
Gene ID | 23411 |
mRNA Refseq | NM_001142498 |
Protein Refseq | NP_001135970 |
MIM | 604479 |
UniProt ID | Q96EB6 |
◆ Recombinant Proteins | ||
SIRT1-101M | Recombinant Mouse SIRT1 protein, His-tagged | +Inquiry |
SIRT1-30565TH | Recombinant Human SIRT1 | +Inquiry |
SIRT1-132H | Recombinant Human SIRT1, His-tagged | +Inquiry |
SIRT1-113H | Recombinant Human SIRT1 Protein, GST-tagged | +Inquiry |
SIRT1-100M | Recombinant Mouse SIRT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT1-595HCL | Recombinant Human SIRT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT1 Products
Required fields are marked with *
My Review for All SIRT1 Products
Required fields are marked with *
0
Inquiry Basket