Recombinant Human SIRT1 protein, His-tagged
| Cat.No. : | SIRT1-6323H |
| Product Overview : | Recombinant Human SIRT1 protein(1-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SIRT1 sirtuin 1 [ Homo sapiens ] |
| Official Symbol | SIRT1 |
| Synonyms | SIRT1; sirtuin 1; sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 1; NAD-dependent deacetylase sirtuin-1; SIR2L1; hSIR2; hSIRT1; SIR2alpha; sir2-like 1; sirtuin type 1; SIR2-like protein 1; |
| Gene ID | 23411 |
| mRNA Refseq | NM_001142498 |
| Protein Refseq | NP_001135970 |
| MIM | 604479 |
| UniProt ID | Q96EB6 |
| ◆ Recombinant Proteins | ||
| SIRT1-1165H | Recombinant Human SIRT1 Protein, His-tagged | +Inquiry |
| SIRT1-658H | Recombinant Human SIRT1, His-tagged | +Inquiry |
| SIRT1-5771H | Recombinant Human SIRT1 Protein (Met193-Ser747), C-His tagged | +Inquiry |
| SIRT1-1360H | Active Recombinant Human SIRT1, His-tagged | +Inquiry |
| SIRT1-3080H | Recombinant Human SIRT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIRT1-595HCL | Recombinant Human SIRT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIRT1 Products
Required fields are marked with *
My Review for All SIRT1 Products
Required fields are marked with *



