Recombinant Human SLC11A2 protein, His-tagged

Cat.No. : SLC11A2-152H
Product Overview : Recombinant Human SLC11A2 protein(NP_000608)(1-80 aa), fused to His tag, was expressed in E. coli.
Availability July 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-80 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 [ Homo sapiens ]
Official Symbol SLC11A2
Synonyms SLC11A2; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2; NRAMP2; natural resistance-associated macrophage protein 2; DCT1; DMT1; DMT-1; NRAMP 2; divalent cation transporter 1; FLJ37416;
Gene ID 4891
mRNA Refseq NM_000617
Protein Refseq NP_000608
MIM 600523
UniProt ID P49281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC11A2 Products

Required fields are marked with *

My Review for All SLC11A2 Products

Required fields are marked with *

0
cart-icon