Recombinant Human SLC11A2 protein, His-tagged
Cat.No. : | SLC11A2-152H |
Product Overview : | Recombinant Human SLC11A2 protein(NP_000608)(1-80 aa), fused to His tag, was expressed in E. coli. |
Availability | July 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-80 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | SLC11A2 solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 [ Homo sapiens ] |
Official Symbol | SLC11A2 |
Synonyms | SLC11A2; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2; NRAMP2; natural resistance-associated macrophage protein 2; DCT1; DMT1; DMT-1; NRAMP 2; divalent cation transporter 1; FLJ37416; |
Gene ID | 4891 |
mRNA Refseq | NM_000617 |
Protein Refseq | NP_000608 |
MIM | 600523 |
UniProt ID | P49281 |
◆ Recombinant Proteins | ||
SLC11A2-0560H | Recombinant Human SLC11A2 Protein (V2-R568), 8×His-MBP, Flag tagged | +Inquiry |
SLC11A2-152H | Recombinant Human SLC11A2 protein, His-tagged | +Inquiry |
SLC11A2-2696H | Recombinant Human SLC11A2, GST-tagged | +Inquiry |
SLC11A2-3847C | Recombinant Chicken SLC11A2 | +Inquiry |
SLC11A2-4218R | Recombinant Rhesus monkey SLC11A2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC11A2 Products
Required fields are marked with *
My Review for All SLC11A2 Products
Required fields are marked with *