Recombinant Human SLC26A4 Protein, His-tagged

Cat.No. : SLC26A4-275H
Product Overview : Recombinant Human SLC26A4 Protein(O43511)(508-780 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 508-780 aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.9 kDa
AASequence : TVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ]
Official Symbol SLC26A4
Synonyms SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS; sodium-independent chloride/iodide transporter; EVA; TDH2B;
Gene ID 5172
mRNA Refseq NM_000441
Protein Refseq NP_000432
MIM 605646
UniProt ID O43511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC26A4 Products

Required fields are marked with *

My Review for All SLC26A4 Products

Required fields are marked with *

0
cart-icon
0
compare icon