Recombinant Human SLC26A4 Protein, His-tagged

• Cat.No.: SLC26A4-275H
• Product Overview: Recombinant Human SLC26A4 Protein(O43511)(508-780 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 508-780 aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.9 kDa
• AASequence: TVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ]
• Official Symbol: SLC26A4
• Synonyms: SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS; sodium-independent chloride/iodide transporter; EVA; TDH2B
• Gene ID: 5172
• mRNA Refseq: NM_000441
• Protein Refseq: NP_000432
• MIM: 605646
• UniProt ID: O43511