Recombinant Human SLC26A4

Cat.No. : SLC26A4-31416TH
Product Overview : Recombinant fragment of Human SLC26A4 with N terminal proprietary tag; Predicted MW 34.54 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 81 amino acids
Description : Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3 of the SLC26A3 gene. The encoded protein has homology to sulfate transporters.
Molecular Weight : 34.540kDa inclusive of tags
Tissue specificity : High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
Sequence Similarities : Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.Contains 1 STAS domain.
Gene Name SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ]
Official Symbol SLC26A4
Synonyms SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS;
Gene ID 5172
mRNA Refseq NM_000441
Protein Refseq NP_000432
MIM 605646
Uniprot ID O43511
Chromosome Location 7q31
Pathway Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function chloride transmembrane transporter activity; iodide transmembrane transporter activity; secondary active sulfate transmembrane transporter activity; sulfate transmembrane transporter activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC26A4 Products

Required fields are marked with *

My Review for All SLC26A4 Products

Required fields are marked with *

0
cart-icon
0
compare icon