Recombinant Human SLC26A4
Cat.No. : | SLC26A4-31416TH |
Product Overview : | Recombinant fragment of Human SLC26A4 with N terminal proprietary tag; Predicted MW 34.54 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 81 amino acids |
Description : | Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3 of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. |
Molecular Weight : | 34.540kDa inclusive of tags |
Tissue specificity : | High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD |
Sequence Similarities : | Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.Contains 1 STAS domain. |
Gene Name | SLC26A4 solute carrier family 26, member 4 [ Homo sapiens ] |
Official Symbol | SLC26A4 |
Synonyms | SLC26A4; solute carrier family 26, member 4; DFNB4; pendrin; PDS; |
Gene ID | 5172 |
mRNA Refseq | NM_000441 |
Protein Refseq | NP_000432 |
MIM | 605646 |
Uniprot ID | O43511 |
Chromosome Location | 7q31 |
Pathway | Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
Function | chloride transmembrane transporter activity; iodide transmembrane transporter activity; secondary active sulfate transmembrane transporter activity; sulfate transmembrane transporter activity; transporter activity; |
◆ Recombinant Proteins | ||
SLC26A4-5485R | Recombinant Rat SLC26A4 Protein | +Inquiry |
SLC26A4-317H | Recombinant Human SLC26A4 protein, GST-tagged | +Inquiry |
SLC26A4-3846H | Recombinant Human SLC26A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC26A4-9278H | Recombinant Human SLC26A4 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC26A4-318H | Recombinant Human SLC26A4 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC26A4 Products
Required fields are marked with *
My Review for All SLC26A4 Products
Required fields are marked with *
0
Inquiry Basket