Recombinant Human SLC2A3

Cat.No. : SLC2A3-27615TH
Product Overview : Recombinant fragment of Human Glucose Transporter GLUT3 (amino acids 213-263) with N terminal proprietary tag, 31.24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 51 amino acids
Molecular Weight : 31.240kDa inclusive of tags
Tissue specificity : Highly expressed in brain. Expressed in many tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRV
Sequence Similarities : Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Gene Name SLC2A3 solute carrier family 2 (facilitated glucose transporter), member 3 [ Homo sapiens ]
Official Symbol SLC2A3
Synonyms SLC2A3; solute carrier family 2 (facilitated glucose transporter), member 3; GLUT3; solute carrier family 2, facilitated glucose transporter member 3;
Gene ID 6515
mRNA Refseq NM_006931
Protein Refseq NP_008862
MIM 138170
Uniprot ID P11169
Chromosome Location 12p13.3
Pathway Facilitative Na+-independent glucose transporters, organism-specific biosystem; Glucose transport, organism-specific biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function glucose transmembrane transporter activity; substrate-specific transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC2A3 Products

Required fields are marked with *

My Review for All SLC2A3 Products

Required fields are marked with *

0
cart-icon