Recombinant Human SLC2A3

• Cat.No.: SLC2A3-27615TH
• Product Overview: Recombinant fragment of Human Glucose Transporter GLUT3 (amino acids 213-263) with N terminal proprietary tag, 31.24kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 51 amino acids
• Molecular Weight: 31.240kDa inclusive of tags
• Tissue specificity: Highly expressed in brain. Expressed in many tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRV
• Sequence Similarities: Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.

Gene Information

• Gene Name: SLC2A3 solute carrier family 2 (facilitated glucose transporter), member 3 [ Homo sapiens ]
• Official Symbol: SLC2A3
• Synonyms: SLC2A3; solute carrier family 2 (facilitated glucose transporter), member 3; GLUT3; solute carrier family 2, facilitated glucose transporter member 3
• Gene ID: 6515
• mRNA Refseq: NM_006931
• Protein Refseq: NP_008862
• MIM: 138170
• Uniprot ID: P11169
• Chromosome Location: 12p13.3
• Pathway: Facilitative Na+-independent glucose transporters, organism-specific biosystem; Glucose transport, organism-specific biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: glucose transmembrane transporter activity; substrate-specific transmembrane transporter activity