Recombinant Human SLC2A3
Cat.No. : | SLC2A3-27615TH |
Product Overview : | Recombinant fragment of Human Glucose Transporter GLUT3 (amino acids 213-263) with N terminal proprietary tag, 31.24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 51 amino acids |
Molecular Weight : | 31.240kDa inclusive of tags |
Tissue specificity : | Highly expressed in brain. Expressed in many tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRV |
Sequence Similarities : | Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. |
Gene Name | SLC2A3 solute carrier family 2 (facilitated glucose transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC2A3 |
Synonyms | SLC2A3; solute carrier family 2 (facilitated glucose transporter), member 3; GLUT3; solute carrier family 2, facilitated glucose transporter member 3; |
Gene ID | 6515 |
mRNA Refseq | NM_006931 |
Protein Refseq | NP_008862 |
MIM | 138170 |
Uniprot ID | P11169 |
Chromosome Location | 12p13.3 |
Pathway | Facilitative Na+-independent glucose transporters, organism-specific biosystem; Glucose transport, organism-specific biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem; Hexose transport, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | glucose transmembrane transporter activity; substrate-specific transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC2A3-27615TH | Recombinant Human SLC2A3 | +Inquiry |
SLC2A3-8313M | Recombinant Mouse SLC2A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A3-0479H | Recombinant Human SLC2A3 Protein (G2-V496), 8×His-MBP, Flag tagged | +Inquiry |
SLC2A3-5497R | Recombinant Rat SLC2A3 Protein | +Inquiry |
SLC2A3-7060C | Recombinant Chicken SLC2A3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A3 Products
Required fields are marked with *
My Review for All SLC2A3 Products
Required fields are marked with *