Recombinant Human SLC39A1 protein, His-tagged
| Cat.No. : | SLC39A1-2746H |
| Product Overview : | Recombinant Human SLC39A1 protein(90-179 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 90-179 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC39A1 solute carrier family 39 (zinc transporter), member 1 [ Homo sapiens ] |
| Official Symbol | SLC39A1 |
| Synonyms | SLC39A1; solute carrier family 39 (zinc transporter), member 1; zinc/iron regulated transporter like , ZIRTL; zinc transporter ZIP1; ZIP1; ZIP-1; hZIP1; zrt- and Irt-like protein 1; solute carrier family 39 member 1; solute carrier family 39 (zinc transporter), member 3; ZIRTL; |
| Gene ID | 27173 |
| mRNA Refseq | NM_014437 |
| Protein Refseq | NP_055252 |
| MIM | 604740 |
| UniProt ID | Q9NY26 |
| ◆ Recombinant Proteins | ||
| SLC39A1-2760H | Recombinant Human SLC39A1, GST-tagged | +Inquiry |
| SLC39A1-11862Z | Recombinant Zebrafish SLC39A1 | +Inquiry |
| SLC39A1-1304H | Recombinant Human SLC39A1 Protein (126-179 aa), His-tagged | +Inquiry |
| SLC39A1-2746H | Recombinant Human SLC39A1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC39A1-608HCL | Recombinant Human SLC39A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A1 Products
Required fields are marked with *
My Review for All SLC39A1 Products
Required fields are marked with *
