Recombinant Human SLC39A1 Protein (126-179 aa), His-tagged

Cat.No. : SLC39A1-1304H
Product Overview : Recombinant Human SLC39A1 Protein (126-179 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 126-179 aa
Description : Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 9.6 kDa
AA Sequence : MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name SLC39A1 solute carrier family 39 (zinc transporter), member 1 [ Homo sapiens ]
Official Symbol SLC39A1
Synonyms SLC39A1; ZIP1; ZIP-1; hZIP1; ZIRTL;
Gene ID 27173
mRNA Refseq NM_014437
Protein Refseq NP_055252
MIM 604740
UniProt ID Q9NY26

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC39A1 Products

Required fields are marked with *

My Review for All SLC39A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon