Recombinant Human SLC39A13 protein, His-tagged
Cat.No. : | SLC39A13-2718H |
Product Overview : | Recombinant Human SLC39A13 protein(1-68 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-68 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALLSGERLDTW |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC39A13 solute carrier family 39 (zinc transporter), member 13 [ Homo sapiens ] |
Official Symbol | SLC39A13 |
Synonyms | SLC39A13; solute carrier family 39 (zinc transporter), member 13; solute carrier family 39 (metal ion transporter), member 13; zinc transporter ZIP13; FLJ25785; LZT-Hs9; zrt- and Irt-like protein 13; LIV-1 subfamily of ZIP zinc transporter 9; |
Gene ID | 91252 |
mRNA Refseq | NM_001128225 |
Protein Refseq | NP_001121697 |
MIM | 608735 |
UniProt ID | Q96H72 |
◆ Recombinant Proteins | ||
SLC39A13-1399Z | Recombinant Zebrafish SLC39A13 | +Inquiry |
SLC39A13-1849C | Recombinant Chicken SLC39A13 | +Inquiry |
RFL22778DF | Recombinant Full Length Danio Rerio Zinc Transporter Zip13(Slc39A13) Protein, His-Tagged | +Inquiry |
SLC39A13-4289R | Recombinant Rhesus monkey SLC39A13 Protein, His-tagged | +Inquiry |
SLC39A13-5531R | Recombinant Rat SLC39A13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A13-1722HCL | Recombinant Human SLC39A13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A13 Products
Required fields are marked with *
My Review for All SLC39A13 Products
Required fields are marked with *
0
Inquiry Basket