Recombinant Human SLC39A7 protein, His-tagged

• Cat.No.: SLC39A7-3987H
• Product Overview: Recombinant Human SLC39A7 protein(237-384 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 237-384 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SLC39A7 solute carrier family 39 (zinc transporter), member 7 [ Homo sapiens ]
• Official Symbol: SLC39A7
• Synonyms: SLC39A7; solute carrier family 39 (zinc transporter), member 7; HKE4, HLA class II region expressed gene KE4; zinc transporter SLC39A7; D6S2244E; H2 KE4; KE4; RING5; ZIP7; Ke4 gene, mouse, human homolog of; solute carrier family 39 member 7; histidine-rich membrane protein Ke4; really interesting new gene 5 protein; HLA class II region expressed gene KE4; HKE4; H2-KE4; D6S115E
• Gene ID: 7922
• mRNA Refseq: NM_001077516
• Protein Refseq: NP_001070984
• MIM: 601416
• UniProt ID: Q92504