Recombinant Human SLC39A7 protein, His-tagged
Cat.No. : | SLC39A7-3987H |
Product Overview : | Recombinant Human SLC39A7 protein(237-384 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237-384 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC39A7 solute carrier family 39 (zinc transporter), member 7 [ Homo sapiens ] |
Official Symbol | SLC39A7 |
Synonyms | SLC39A7; solute carrier family 39 (zinc transporter), member 7; HKE4, HLA class II region expressed gene KE4; zinc transporter SLC39A7; D6S2244E; H2 KE4; KE4; RING5; ZIP7; Ke4 gene, mouse, human homolog of; solute carrier family 39 member 7; histidine-rich membrane protein Ke4; really interesting new gene 5 protein; HLA class II region expressed gene KE4; HKE4; H2-KE4; D6S115E; |
Gene ID | 7922 |
mRNA Refseq | NM_001077516 |
Protein Refseq | NP_001070984 |
MIM | 601416 |
UniProt ID | Q92504 |
◆ Recombinant Proteins | ||
SLC39A7-657H | Recombinant Human SLC39A7 Protein (1-469 aa), GST-tagged | +Inquiry |
SLC39A7-6546H | Recombinant Human SLC39A7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC39A7-15440M | Recombinant Mouse SLC39A7 Protein | +Inquiry |
SLC39A7-1353S | Recombinant Human SLC39A7 Protein (A2-E469), 8×His-MBP, Flag tagged | +Inquiry |
SLC39A7-8572Z | Recombinant Zebrafish SLC39A7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A7 Products
Required fields are marked with *
My Review for All SLC39A7 Products
Required fields are marked with *
0
Inquiry Basket