Recombinant Human SLC39A7 protein, His-tagged
| Cat.No. : | SLC39A7-3987H |
| Product Overview : | Recombinant Human SLC39A7 protein(237-384 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 237-384 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC39A7 solute carrier family 39 (zinc transporter), member 7 [ Homo sapiens ] |
| Official Symbol | SLC39A7 |
| Synonyms | SLC39A7; solute carrier family 39 (zinc transporter), member 7; HKE4, HLA class II region expressed gene KE4; zinc transporter SLC39A7; D6S2244E; H2 KE4; KE4; RING5; ZIP7; Ke4 gene, mouse, human homolog of; solute carrier family 39 member 7; histidine-rich membrane protein Ke4; really interesting new gene 5 protein; HLA class II region expressed gene KE4; HKE4; H2-KE4; D6S115E; |
| Gene ID | 7922 |
| mRNA Refseq | NM_001077516 |
| Protein Refseq | NP_001070984 |
| MIM | 601416 |
| UniProt ID | Q92504 |
| ◆ Recombinant Proteins | ||
| SLC39A7-6804HF | Recombinant Full Length Human SLC39A7 Protein, GST-tagged | +Inquiry |
| SLC39A7-3987H | Recombinant Human SLC39A7 protein, His-tagged | +Inquiry |
| SLC39A7-657H | Recombinant Human SLC39A7 Protein (1-469 aa), GST-tagged | +Inquiry |
| SLC39A7-1352S | Recombinant Human SLC39A7 Protein (V2-M541), 8×His-MBP, Flag tagged | +Inquiry |
| RFL19911SF | Recombinant Full Length Pig Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A7 Products
Required fields are marked with *
My Review for All SLC39A7 Products
Required fields are marked with *
