Recombinant Human SLC39A7 protein, His-tagged
Cat.No. : | SLC39A7-3987H |
Product Overview : | Recombinant Human SLC39A7 protein(237-384 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237-384 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SLC39A7 solute carrier family 39 (zinc transporter), member 7 [ Homo sapiens ] |
Official Symbol | SLC39A7 |
Synonyms | SLC39A7; solute carrier family 39 (zinc transporter), member 7; HKE4, HLA class II region expressed gene KE4; zinc transporter SLC39A7; D6S2244E; H2 KE4; KE4; RING5; ZIP7; Ke4 gene, mouse, human homolog of; solute carrier family 39 member 7; histidine-rich membrane protein Ke4; really interesting new gene 5 protein; HLA class II region expressed gene KE4; HKE4; H2-KE4; D6S115E; |
Gene ID | 7922 |
mRNA Refseq | NM_001077516 |
Protein Refseq | NP_001070984 |
MIM | 601416 |
UniProt ID | Q92504 |
◆ Recombinant Proteins | ||
SLC39A7-657H | Recombinant Human SLC39A7 Protein (1-469 aa), GST-tagged | +Inquiry |
SLC39A7-6546H | Recombinant Human SLC39A7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL429PF | Recombinant Full Length Pongo Abelii Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
SLC39A7-8572Z | Recombinant Zebrafish SLC39A7 | +Inquiry |
RFL14096MF | Recombinant Full Length Mouse Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A7 Products
Required fields are marked with *
My Review for All SLC39A7 Products
Required fields are marked with *