Recombinant Human SLC5A5 protein, His-tagged
| Cat.No. : | SLC5A5-2778H |
| Product Overview : | Recombinant Human SLC5A5 protein(539-643 aa), fused with His tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 539-643 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC5A5 solute carrier family 5 (sodium iodide symporter), member 5 [ Homo sapiens ] |
| Official Symbol | SLC5A5 |
| Synonyms | SLC5A5; solute carrier family 5 (sodium iodide symporter), member 5; sodium/iodide cotransporter; NIS; Na(+)/I(-) symporter; Na(+)/I(-) cotransporter; TDH1; |
| Gene ID | 6528 |
| mRNA Refseq | NM_000453 |
| Protein Refseq | NP_000444 |
| MIM | 601843 |
| UniProt ID | Q92911 |
| ◆ Recombinant Proteins | ||
| SLC5A5-82HCL | Recombinant Human SLC5A5 cell lysate, Myc/DDK-tagged | +Inquiry |
| SLC5A5-743H | Recombinant Human SLC5A5 protein, His-tagged | +Inquiry |
| SLC5A5-1207H | Recombinant Human SLC5A5 protein, His & GST-tagged | +Inquiry |
| SLC5A5-2778H | Recombinant Human SLC5A5 protein, His-tagged | +Inquiry |
| SLC5A5-5534Z | Recombinant Zebrafish SLC5A5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC5A5 Products
Required fields are marked with *
My Review for All SLC5A5 Products
Required fields are marked with *
