Recombinant Human SLC5A5 protein, His-tagged

Cat.No. : SLC5A5-2778H
Product Overview : Recombinant Human SLC5A5 protein(539-643 aa), fused with His tag, was expressed in E.coli.
Availability August 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 539-643 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC5A5 solute carrier family 5 (sodium iodide symporter), member 5 [ Homo sapiens ]
Official Symbol SLC5A5
Synonyms SLC5A5; solute carrier family 5 (sodium iodide symporter), member 5; sodium/iodide cotransporter; NIS; Na(+)/I(-) symporter; Na(+)/I(-) cotransporter; TDH1;
Gene ID 6528
mRNA Refseq NM_000453
Protein Refseq NP_000444
MIM 601843
UniProt ID Q92911

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC5A5 Products

Required fields are marked with *

My Review for All SLC5A5 Products

Required fields are marked with *

0
cart-icon
0
compare icon