Recombinant Human SLC5A5 protein, His-tagged
| Cat.No. : | SLC5A5-743H |
| Product Overview : | Recombinant Human SLC5A5 protein(Q92911)(547-643aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 547-643a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
| Gene Name | SLC5A5 solute carrier family 5 (sodium iodide symporter), member 5 [ Homo sapiens ] |
| Official Symbol | SLC5A5 |
| Synonyms | SLC5A5; solute carrier family 5 (sodium iodide symporter), member 5; sodium/iodide cotransporter; NIS; Na(+)/I(-) symporter; Na(+)/I(-) cotransporter; TDH1; |
| Gene ID | 6528 |
| mRNA Refseq | NM_000453 |
| Protein Refseq | NP_000444 |
| MIM | 601843 |
| UniProt ID | Q92911 |
| ◆ Recombinant Proteins | ||
| SLC5A5-82HCL | Recombinant Human SLC5A5 cell lysate, Myc/DDK-tagged | +Inquiry |
| SLC5A5-2778H | Recombinant Human SLC5A5 protein, His-tagged | +Inquiry |
| SLC5A5-5534Z | Recombinant Zebrafish SLC5A5 | +Inquiry |
| SLC5A5-1207H | Recombinant Human SLC5A5 protein, His & GST-tagged | +Inquiry |
| SLC5A5-743H | Recombinant Human SLC5A5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC5A5 Products
Required fields are marked with *
My Review for All SLC5A5 Products
Required fields are marked with *
