Recombinant Human SLC6A1 protein, His-tagged
| Cat.No. : | SLC6A1-3326H |
| Product Overview : | Recombinant Human SLC6A1 protein(1-52 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-52 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC6A1 solute carrier family 6 (neurotransmitter transporter, GABA), member 1 [ Homo sapiens ] |
| Official Symbol | SLC6A1 |
| Synonyms | SLC6A1; solute carrier family 6 (neurotransmitter transporter, GABA), member 1; sodium- and chloride-dependent GABA transporter 1; GABATHG; GABATR; GAT1; GAT-1; solute carrier family 6 member 1; |
| Gene ID | 6529 |
| mRNA Refseq | NM_003042 |
| Protein Refseq | NP_003033 |
| MIM | 137165 |
| UniProt ID | P30531 |
| ◆ Recombinant Proteins | ||
| SLC6A1-1796H | Recombinant Human SLC6A1 protein, GST-tagged | +Inquiry |
| SLC6A1-5561R | Recombinant Rat SLC6A1 Protein | +Inquiry |
| SLC6A1-5220R | Recombinant Rat SLC6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC6A1-8403M | Recombinant Mouse SLC6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC6A1-3326H | Recombinant Human SLC6A1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC6A1 Products
Required fields are marked with *
My Review for All SLC6A1 Products
Required fields are marked with *
