Recombinant Human SLC7A11 protein, GST-tagged
| Cat.No. : | SLC7A11-301456H |
| Product Overview : | Recombinant Human SLC7A11 (211-265 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met211-Thr265 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | MQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ] |
| Official Symbol | SLC7A11 |
| Synonyms | SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1; |
| Gene ID | 23657 |
| mRNA Refseq | NM_014331 |
| Protein Refseq | NP_055146 |
| MIM | 607933 |
| UniProt ID | Q9UPY5 |
| ◆ Recombinant Proteins | ||
| Slc7a11-2080M | Recombinant Mouse Slc7a11 Protein, His-tagged | +Inquiry |
| SLC7A11-4311R | Recombinant Rhesus monkey SLC7A11 Protein, His-tagged | +Inquiry |
| SLC7A11-481HF | Recombinant Full Length Human SLC7A11 Protein, GST-tagged | +Inquiry |
| SLC7A11-30700TH | Recombinant Human SLC7A11 protein, GST-tagged | +Inquiry |
| RFL33376HF | Recombinant Human Cystine/Glutamate Transporter(Slc7A11) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A11 Products
Required fields are marked with *
My Review for All SLC7A11 Products
Required fields are marked with *
