Recombinant Human SLC7A11 protein, GST-tagged
| Cat.No. : | SLC7A11-30700TH |
| Product Overview : | Recombinant Human SLC7A11(1 a.a. - 501 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-501 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 81.8 kDa |
| AA Sequence : | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ] |
| Official Symbol | SLC7A11 |
| Synonyms | SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1; |
| Gene ID | 23657 |
| mRNA Refseq | NM_014331 |
| Protein Refseq | NP_055146 |
| MIM | 607933 |
| UniProt ID | Q9UPY5 |
| Chromosome Location | 4q28-q32 |
| Function | amino acid transmembrane transporter activity; cystine:glutamate antiporter activity; protein binding; |
| ◆ Recombinant Proteins | ||
| SLC7A11-301456H | Recombinant Human SLC7A11 protein, GST-tagged | +Inquiry |
| SLC7A11-25H | Recombinant Human SLC7A11 Protein, Fc tagged | +Inquiry |
| SLC7A11-01H | Recombinant Human SLC7A11 Protein, His-tagged | +Inquiry |
| SLC7A11-49567H | Active Recombinant Human SLC7A11 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| SLC7A11-4311R | Recombinant Rhesus monkey SLC7A11 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A11 Products
Required fields are marked with *
My Review for All SLC7A11 Products
Required fields are marked with *




