Recombinant Human SLC7A11 protein, GST-tagged
Cat.No. : | SLC7A11-30700TH |
Product Overview : | Recombinant Human SLC7A11(1 a.a. - 501 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-501 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ] |
Official Symbol | SLC7A11 |
Synonyms | SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1; |
Gene ID | 23657 |
mRNA Refseq | NM_014331 |
Protein Refseq | NP_055146 |
MIM | 607933 |
UniProt ID | Q9UPY5 |
Chromosome Location | 4q28-q32 |
Function | amino acid transmembrane transporter activity; cystine:glutamate antiporter activity; protein binding; |
◆ Recombinant Proteins | ||
SLC7A11-6253H | Recombinant Human SLC7A11 protein, His-tagged | +Inquiry |
SLC7A11-01H | Recombinant Human SLC7A11 Protein, His-tagged | +Inquiry |
Slc7a11-2080M | Recombinant Mouse Slc7a11 Protein, His-tagged | +Inquiry |
SLC7A11-2957H | Active Recombinant Human SLC7A11 Full Length Transmembrane protein, His-tagged | +Inquiry |
SLC7A11-301337H | Recombinant Human SLC7A11 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A11-1698HCL | Recombinant Human SLC7A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A11 Products
Required fields are marked with *
My Review for All SLC7A11 Products
Required fields are marked with *
0
Inquiry Basket