Recombinant Human SLC7A11 protein, GST-tagged

Cat.No. : SLC7A11-30700TH
Product Overview : Recombinant Human SLC7A11(1 a.a. - 501 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-501 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 81.8 kDa
AA Sequence : MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ]
Official Symbol SLC7A11
Synonyms SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1;
Gene ID 23657
mRNA Refseq NM_014331
Protein Refseq NP_055146
MIM 607933
UniProt ID Q9UPY5
Chromosome Location 4q28-q32
Function amino acid transmembrane transporter activity; cystine:glutamate antiporter activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC7A11 Products

Required fields are marked with *

My Review for All SLC7A11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon