Recombinant Human SLC9A3 Protein, His-tagged
| Cat.No. : | SLC9A3-30H |
| Product Overview : | Recombinant Human SLC9A3 Protein(P48764)(601-730 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 601-730 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 17 kDa |
| AASequence : | LEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEEM |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| Gene Name | SLC9A3 solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 [ Homo sapiens ] |
| Official Symbol | SLC9A3 |
| Synonyms | SLC9A3; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 , solute carrier family 9 (sodium/hydrogen exchanger), member 3; sodium/hydrogen exchanger 3; NHE-3; Na(+)/H(+) exchanger 3; solute carrier family 9 member 3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; NHE3; MGC126718; MGC126720; |
| Gene ID | 6550 |
| mRNA Refseq | NM_004174 |
| Protein Refseq | NP_004165 |
| MIM | 182307 |
| UniProt ID | P48764 |
| ◆ Recombinant Proteins | ||
| SLC9A3-5586R | Recombinant Rat SLC9A3 Protein | +Inquiry |
| SLC9A3-31431TH | Recombinant Human SLC9A3 | +Inquiry |
| SLC9A3-5245R | Recombinant Rat SLC9A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC9A3-30H | Recombinant Human SLC9A3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC9A3 Products
Required fields are marked with *
My Review for All SLC9A3 Products
Required fields are marked with *



