Recombinant Human SLC9A3 Protein, His-tagged

Cat.No. : SLC9A3-30H
Product Overview : Recombinant Human SLC9A3 Protein(P48764)(601-730 aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 601-730 aa
Form : Phosphate buffered saline.
Molecular Mass : 17 kDa
AASequence : LEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEEM
Storage : Store at -20°C to -80°C.
Concentration : 0.1-1.0 mg/ml
Gene Name SLC9A3 solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 [ Homo sapiens ]
Official Symbol SLC9A3
Synonyms SLC9A3; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3; NHE3, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 , solute carrier family 9 (sodium/hydrogen exchanger), member 3; sodium/hydrogen exchanger 3; NHE-3; Na(+)/H(+) exchanger 3; solute carrier family 9 member 3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; NHE3; MGC126718; MGC126720;
Gene ID 6550
mRNA Refseq NM_004174
Protein Refseq NP_004165
MIM 182307
UniProt ID P48764

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC9A3 Products

Required fields are marked with *

My Review for All SLC9A3 Products

Required fields are marked with *

0
cart-icon
0
compare icon