Recombinant Human SLN protein(1-31aa), His-KSI-tagged
Cat.No. : | SLN-578H |
Product Overview : | Recombinant Human SLN protein(O00631)(1-31aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-31aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MGINTRELFLNFTIVLITVILMWLLVRSYQY |
Gene Name | SLN sarcolipin [ Homo sapiens ] |
Official Symbol | SLN |
Synonyms | SLN; sarcolipin; MGC12301; MGC125854; MGC125855; |
Gene ID | 6588 |
mRNA Refseq | NM_003063 |
Protein Refseq | NP_003054 |
MIM | 602203 |
UniProt ID | O00631 |
◆ Recombinant Proteins | ||
SLN-30127H | Recombinant Human SLN protein, GST-tagged | +Inquiry |
SLN-8452M | Recombinant Mouse SLN Protein, His (Fc)-Avi-tagged | +Inquiry |
SLN-2081H | Recombinant Human SLN Protein, His&GST-tagged | +Inquiry |
SLN-8517Z | Recombinant Zebrafish SLN | +Inquiry |
SLN-578H | Recombinant Human SLN protein(1-31aa), His-KSI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLN-1680HCL | Recombinant Human SLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLN Products
Required fields are marked with *
My Review for All SLN Products
Required fields are marked with *