Recombinant Human SLN protein(1-31aa), His-KSI-tagged

• Cat.No.: SLN-578H
• Product Overview: Recombinant Human SLN protein(O00631)(1-31aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 1-31aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY

Gene Information

• Gene Name: SLN sarcolipin [ Homo sapiens ]
• Official Symbol: SLN
• Synonyms: SLN; sarcolipin; MGC12301; MGC125854; MGC125855
• Gene ID: 6588
• mRNA Refseq: NM_003063
• Protein Refseq: NP_003054
• MIM: 602203
• UniProt ID: O00631