Recombinant Human SLN protein, GST-tagged
| Cat.No. : | SLN-30127H |
| Product Overview : | Recombinant Human SLN (1-31 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Tyr31 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MGINTRELFLNFTIVLITVILMWLLVRSYQY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Gene Name | SLN sarcolipin [ Homo sapiens ] |
| Official Symbol | SLN |
| Synonyms | SLN; sarcolipin; MGC12301; MGC125854; MGC125855; |
| Gene ID | 6588 |
| mRNA Refseq | NM_003063 |
| Protein Refseq | NP_003054 |
| MIM | 602203 |
| UniProt ID | O00631 |
| ◆ Recombinant Proteins | ||
| SLN-5657C | Recombinant Chicken SLN | +Inquiry |
| SLN-30127H | Recombinant Human SLN protein, GST-tagged | +Inquiry |
| SLN-578H | Recombinant Human SLN protein(1-31aa), His-KSI-tagged | +Inquiry |
| SLN-8517Z | Recombinant Zebrafish SLN | +Inquiry |
| SLN-5605R | Recombinant Rat SLN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLN-1680HCL | Recombinant Human SLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLN Products
Required fields are marked with *
My Review for All SLN Products
Required fields are marked with *



