Recombinant Human SLN protein, GST-tagged
| Cat.No. : | SLN-30127H |
| Product Overview : | Recombinant Human SLN (1-31 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
| Source : | E. coli |
| Species : | Human |
| Tag : | GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Protein length : | Met1-Tyr31 |
| AA Sequence : | MGINTRELFLNFTIVLITVILMWLLVRSYQY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Gene Name : | SLN sarcolipin [ Homo sapiens ] |
| Official Symbol : | SLN |
| Synonyms : | SLN; sarcolipin; MGC12301; MGC125854; MGC125855; |
| Gene ID : | 6588 |
| mRNA Refseq : | NM_003063 |
| Protein Refseq : | NP_003054 |
| MIM : | 602203 |
| UniProt ID : | O00631 |
Products Types
| ◆ Recombinant Protein | ||
| SLN-5264R | Recombinant Rat SLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLN-2081H | Recombinant Human SLN Protein, His&GST-tagged | +Inquiry |
| SLN-8452M | Recombinant Mouse SLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLN-15574M | Recombinant Mouse SLN Protein | +Inquiry |
| SLN-8517Z | Recombinant Zebrafish SLN | +Inquiry |
| ◆ Lysates | ||
| SLN-1680HCL | Recombinant Human SLN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
