Recombinant Human SLN protein, GST-tagged

Cat.No. : SLN-30127H
Product Overview : Recombinant Human SLN (1-31 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Tyr31
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MGINTRELFLNFTIVLITVILMWLLVRSYQY
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Gene Name SLN sarcolipin [ Homo sapiens ]
Official Symbol SLN
Synonyms SLN; sarcolipin; MGC12301; MGC125854; MGC125855;
Gene ID 6588
mRNA Refseq NM_003063
Protein Refseq NP_003054
MIM 602203
UniProt ID O00631

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLN Products

Required fields are marked with *

My Review for All SLN Products

Required fields are marked with *

0
cart-icon