Recombinant Human SLPI protein, His&Myc-tagged
Cat.No. : | SLPI-3504H |
Product Overview : | Recombinant Human SLPI protein(P03973)(26-132aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 26-132aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ] |
Official Symbol | SLPI |
Synonyms | SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4; HUSI-1; protease inhibitor WAP4; mucus proteinase inhibitor; seminal proteinase inhibitor; WAP four-disulfide core domain protein 4; MPI; HUSI-I; |
Gene ID | 6590 |
mRNA Refseq | NM_003064 |
Protein Refseq | NP_003055 |
MIM | 107285 |
UniProt ID | P03973 |
◆ Recombinant Proteins | ||
SLPI-2036H | Recombinant Human SLPI Protein, His (Fc)-Avi-tagged | +Inquiry |
SLPI-2575H | Recombinant Human Secretory Leukocyte Peptidase Inhibitor, His-tagged | +Inquiry |
SLPI-4142R | Recombinant Rhesus Macaque SLPI Protein, His (Fc)-Avi-tagged | +Inquiry |
SLPI-950HFL | Recombinant Full Length Human SLPI Protein, C-Flag-tagged | +Inquiry |
SLPI-2349H | Recombinant Human SLPI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLPI-001HCL | Recombinant Human SLPI cell lysate | +Inquiry |
SLPI-530HCL | Recombinant Human SLPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLPI Products
Required fields are marked with *
My Review for All SLPI Products
Required fields are marked with *