Recombinant Human SLURP1 Protein (23-103 aa), His-tagged

Cat.No. : SLURP1-2333H
Product Overview : Recombinant Human SLURP1 Protein (23-103 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 23-103 aa
Description : Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 10.9 kDa
AA Sequence : LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens ]
Official Symbol SLURP1
Synonyms SLURP1; ANUP; ARS; ARS component B; ArsB; LY6LS; MDM; SLURP-1; ARS(component B)-81/S;
Gene ID 57152
mRNA Refseq NM_020427
Protein Refseq NP_065160
MIM 606119
UniProt ID P55000

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLURP1 Products

Required fields are marked with *

My Review for All SLURP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon