Recombinant Human SLURP1 Protein (23-103 aa), His-tagged
Cat.No. : | SLURP1-2333H |
Product Overview : | Recombinant Human SLURP1 Protein (23-103 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-103 aa |
Description : | Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 10.9 kDa |
AA Sequence : | LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens ] |
Official Symbol | SLURP1 |
Synonyms | SLURP1; ANUP; ARS; ARS component B; ArsB; LY6LS; MDM; SLURP-1; ARS(component B)-81/S; |
Gene ID | 57152 |
mRNA Refseq | NM_020427 |
Protein Refseq | NP_065160 |
MIM | 606119 |
UniProt ID | P55000 |
◆ Recombinant Proteins | ||
SLURP1-8454M | Recombinant Mouse SLURP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLURP1-2333H | Recombinant Human SLURP1 Protein (23-103 aa), His-tagged | +Inquiry |
SLURP1-801HFL | Recombinant Full Length Human SLURP1 Protein, C-Flag-tagged | +Inquiry |
SLURP1-5036H | Recombinant Human SLURP1 Protein (Met1-Leu103), His tagged | +Inquiry |
SLURP1-15578M | Recombinant Mouse SLURP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLURP1-1642HCL | Recombinant Human SLURP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLURP1 Products
Required fields are marked with *
My Review for All SLURP1 Products
Required fields are marked with *
0
Inquiry Basket