Recombinant Human SLURP1 Protein (23-103 aa), His-tagged

• Cat.No.: SLURP1-2333H
• Product Overview: Recombinant Human SLURP1 Protein (23-103 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 23-103 aa
• Description: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 10.9 kDa
• AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens ]
• Official Symbol: SLURP1
• Synonyms: SLURP1; ANUP; ARS; ARS component B; ArsB; LY6LS; MDM; SLURP-1; ARS(component B)-81/S
• Gene ID: 57152
• mRNA Refseq: NM_020427
• Protein Refseq: NP_065160
• MIM: 606119
• UniProt ID: P55000