Recombinant Human SMAD family member 5 Protein, His tagged

Cat.No. : SMAD5-001H
Product Overview : Recombinant Human SMAD5 Protein (155-258aa) with His tag was expressed in E. coli.
Availability November 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 155-258aa
Description : The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.
Tag : C-His
Molecular Mass : 12 kDa
AA Sequence : MVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name SMAD5 SMAD family member 5 [ Homo sapiens (human) ]
Official Symbol SMAD5
Synonyms SMAD5; SMAD family member 5; MAD, mothers against decapentaplegic homolog 5 (Drosophila) , MADH5, SMAD, mothers against DPP homolog 5 (Drosophila); mothers against decapentaplegic homolog 5; Dwfc; JV5 1; SMA- and MAD-related protein 5; SMAD, mothers against DPP homolog 5; MAD, mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; DWFC; JV5-1; MADH5; DKFZp781C1895; DKFZp781O1323
Gene ID 4090
mRNA Refseq NM_001001419
Protein Refseq NP_001001419
MIM 603110
UniProt ID Q99717

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMAD5 Products

Required fields are marked with *

My Review for All SMAD5 Products

Required fields are marked with *

0
cart-icon
0
compare icon