Recombinant Human SMAD family member 5 Protein, His tagged
Cat.No. : | SMAD5-001H |
Product Overview : | Recombinant Human SMAD5 Protein (155-258aa) with His tag was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 155-258aa |
Description : | The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants. |
Tag : | C-His |
Molecular Mass : | 12 kDa |
AA Sequence : | MVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | SMAD5 SMAD family member 5 [ Homo sapiens (human) ] |
Official Symbol | SMAD5 |
Synonyms | SMAD5; SMAD family member 5; MAD, mothers against decapentaplegic homolog 5 (Drosophila) , MADH5, SMAD, mothers against DPP homolog 5 (Drosophila); mothers against decapentaplegic homolog 5; Dwfc; JV5 1; SMA- and MAD-related protein 5; SMAD, mothers against DPP homolog 5; MAD, mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; DWFC; JV5-1; MADH5; DKFZp781C1895; DKFZp781O1323 |
Gene ID | 4090 |
mRNA Refseq | NM_001001419 |
Protein Refseq | NP_001001419 |
MIM | 603110 |
UniProt ID | Q99717 |
◆ Recombinant Proteins | ||
Smad5-8679M | Recombinant Mouse Smad5, His-GST tagged | +Inquiry |
SMAD5-31194TH | Recombinant Human SMAD5 | +Inquiry |
SMAD5-479M | Recombinant Mouse Smad5, Gly & Pro tagged | +Inquiry |
SMAD5-1493H | Recombinant Human SMAD Family Member 5, GST-tagged | +Inquiry |
SMAD5-8946Z | Recombinant Zebrafish SMAD5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMAD5-001MCL | Recombinant Mouse SMAD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD5 Products
Required fields are marked with *
My Review for All SMAD5 Products
Required fields are marked with *