Recombinant Human SMAD1 protein, GST-tagged
Cat.No. : | SMAD1-43H |
Product Overview : | Recombinant Human SMAD1(Met1-Ser465) fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-465 a.a. |
Description : | SMAD Family Member 1 (SMAD1) is a member of the dwarfin/SMAD family. SMAD1 has the highest expression in the heart and skeletal muscle, containing one MAD homology 1 domain and one MAD homology 2 domain, As a transcriptional modulator SMAD 1 is activated by bone morphogenetic proteins type 1 receptor kinase. Defects in SMAD1 may cause primary pulmonary hypertension (PPH1), characterized by plexiform lesions of proliferating endothelial cells in pulmonary arterioles. The lesions lead to elevated pulmonary arterial pression, right ventricular failure and death. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKA VDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQ SHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNE PHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYL PPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTS VLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSR NCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAE YHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | SMAD1 SMAD family member 1 [ Homo sapiens ] |
Official Symbol | SMAD1 |
Synonyms | SMAD1; SMAD family member 1; MAD, mothers against decapentaplegic homolog 1 (Drosophila) , MADH1, SMAD, mothers against DPP homolog 1 (Drosophila); mothers against decapentaplegic homolog 1; JV4 1; MADR1; MAD homolog 1; Mad-related protein 1; TGF-beta signaling protein 1; mothers against DPP homolog 1; SMAD, mothers against DPP homolog 1; MAD, mothers against decapentaplegic homolog 1; transforming growth factor-beta signaling protein 1; transforming growth factor-beta-signaling protein 1; BSP1; JV41; BSP-1; JV4-1; MADH1; |
Gene ID | 4086 |
mRNA Refseq | NM_001003688 |
Protein Refseq | NP_001003688 |
MIM | 601595 |
UniProt ID | Q15797 |
◆ Recombinant Proteins | ||
SMAD1-4493C | Recombinant Chicken SMAD1 | +Inquiry |
SMAD1-30445TH | Recombinant Human SMAD1 | +Inquiry |
SMAD1-8456M | Recombinant Mouse SMAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMAD1-4145R | Recombinant Rhesus Macaque SMAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMAD1-4856HFL | Recombinant Full Length Human SMAD1, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMAD1-1678HCL | Recombinant Human SMAD1 293 Cell Lysate | +Inquiry |
SMAD1-1677HCL | Recombinant Human SMAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMAD1 Products
Required fields are marked with *
My Review for All SMAD1 Products
Required fields are marked with *