Recombinant Human SMIM14 Protein, GST-tagged
Cat.No. : | SMIM14-5234H |
Product Overview : | Human C4orf34 full-length ORF (AAH08502.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ] |
Official Symbol | SMIM14 |
Synonyms | Small Integral Membrane Protein 14; C4orf34; Chromosome 4 Open Reading Frame 34; SMIM14; small integral membrane protein 14; small integral membrane protein 14 |
Gene ID | 201895 |
mRNA Refseq | NM_001317896 |
Protein Refseq | NP_001304825 |
UniProt ID | Q96QK8 |
◆ Cell & Tissue Lysates | ||
SMIM14-8027HCL | Recombinant Human C4orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMIM14 Products
Required fields are marked with *
My Review for All SMIM14 Products
Required fields are marked with *