Recombinant Human SMIM14 Protein, GST-tagged

Cat.No. : SMIM14-5234H
Product Overview : Human C4orf34 full-length ORF (AAH08502.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene.
Molecular Mass : 37.29 kDa
AA Sequence : MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ]
Official Symbol SMIM14
Synonyms Small Integral Membrane Protein 14; C4orf34; Chromosome 4 Open Reading Frame 34; SMIM14; small integral membrane protein 14; small integral membrane protein 14
Gene ID 201895
mRNA Refseq NM_001317896
Protein Refseq NP_001304825
UniProt ID Q96QK8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMIM14 Products

Required fields are marked with *

My Review for All SMIM14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon