Recombinant Human SMS protein, GST-tagged
Cat.No. : | SMS-8789H |
Product Overview : | Recombinant Human SMS protein(1-366 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-366 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SMS spermine synthase [ Homo sapiens ] |
Official Symbol | SMS |
Synonyms | SMS; spermine synthase; Snyder Robinson X linked mental retardation syndrome , SRS; MRSR; SPMSY; SpS; spermidine aminopropyltransferase; Snyder-Robinson X-linked mental retardation syndrome; SRS; |
mRNA Refseq | NM_004595 |
Protein Refseq | NP_004586 |
MIM | 300105 |
UniProt ID | P52788 |
Gene ID | 6611 |
◆ Recombinant Proteins | ||
SMS-2824H | Recombinant Human SMS protein, His-tagged | +Inquiry |
SMS-485HF | Recombinant Full Length Human SMS Protein | +Inquiry |
SMS-1573H | Recombinant Human Spermine Synthase, His-tagged | +Inquiry |
SMS-30398TH | Recombinant Human SMS, His-tagged | +Inquiry |
SMS-15648M | Recombinant Mouse SMS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMS-1651HCL | Recombinant Human SMS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMS Products
Required fields are marked with *
My Review for All SMS Products
Required fields are marked with *