Recombinant Human SNAI2 protein, His-tagged
| Cat.No. : | SNAI2-2711H |
| Product Overview : | Recombinant Human SNAI2 protein(1-268 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | September 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-268 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | SNAI2 |
| Synonyms | SNAI2; snail homolog 2 (Drosophila); SLUG, slug homolog, zinc finger protein (chicken); zinc finger protein SNAI2; SLUGH1; SNAIL2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; SLUG; WS2D; MGC10182; |
| Gene ID | 6591 |
| mRNA Refseq | NM_003068 |
| Protein Refseq | NP_003059 |
| MIM | 602150 |
| UniProt ID | O43623 |
| ◆ Recombinant Proteins | ||
| SNAI2-5631R | Recombinant Rat SNAI2 Protein | +Inquiry |
| SNAI2-58H | Recombinant Human SNAI2, His-tagged | +Inquiry |
| SNAI2-2711H | Recombinant Human SNAI2 protein, His-tagged | +Inquiry |
| SNAI2-2829H | Recombinant Human SNAI2 protein, GST-tagged | +Inquiry |
| SNAI2-4355R | Recombinant Rhesus monkey SNAI2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNAI2-1642HCL | Recombinant Human SNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI2 Products
Required fields are marked with *
My Review for All SNAI2 Products
Required fields are marked with *
