Recombinant Human SNAI2 protein, His-tagged
Cat.No. : | SNAI2-2711H |
Product Overview : | Recombinant Human SNAI2 protein(1-268 aa), fused to His tag, was expressed in E. coli. |
Availability | September 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-268 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | SNAI2 |
Synonyms | SNAI2; snail homolog 2 (Drosophila); SLUG, slug homolog, zinc finger protein (chicken); zinc finger protein SNAI2; SLUGH1; SNAIL2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; SLUG; WS2D; MGC10182; |
Gene ID | 6591 |
mRNA Refseq | NM_003068 |
Protein Refseq | NP_003059 |
MIM | 602150 |
UniProt ID | O43623 |
◆ Recombinant Proteins | ||
SNAI2-5290R | Recombinant Rat SNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAI2-5631R | Recombinant Rat SNAI2 Protein | +Inquiry |
SNAI2-2711H | Recombinant Human SNAI2 protein, His-tagged | +Inquiry |
SNAI2-4171R | Recombinant Rhesus Macaque SNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAI2-1879Z | Recombinant Zebrafish SNAI2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI2-1642HCL | Recombinant Human SNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI2 Products
Required fields are marked with *
My Review for All SNAI2 Products
Required fields are marked with *