Recombinant Human SNAI2 protein, His-tagged

Cat.No. : SNAI2-2711H
Product Overview : Recombinant Human SNAI2 protein(1-268 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability May 22, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-268 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol SNAI2
Synonyms SNAI2; snail homolog 2 (Drosophila); SLUG, slug homolog, zinc finger protein (chicken); zinc finger protein SNAI2; SLUGH1; SNAIL2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; SLUG; WS2D; MGC10182;
Gene ID 6591
mRNA Refseq NM_003068
Protein Refseq NP_003059
MIM 602150
UniProt ID O43623

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAI2 Products

Required fields are marked with *

My Review for All SNAI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon