Recombinant Human SNCA protein, GST-tagged
| Cat.No. : | SNCA-3509H |
| Product Overview : | Recombinant Human SNCA protein(P37840)(1-139AA), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-139AA |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.4 kDa |
| AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
| Official Symbol | SNCA |
| Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
| Gene ID | 6622 |
| mRNA Refseq | NM_000345 |
| Protein Refseq | NP_000336 |
| MIM | 163890 |
| UniProt ID | P37840 |
| ◆ Recombinant Proteins | ||
| SNCA-295H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 1-95 | +Inquiry |
| SNCA-035H | Recombinant Human synuclein, alpha Protein, Tag Free, Fluor 488 Labeled | +Inquiry |
| SNCA-385H | Recombinant Human SNCA Protein | +Inquiry |
| SNCA-27338TH | Recombinant Human SNCA, His-tagged | +Inquiry |
| Snca-1890C | Active Recombinant Cynomolgus Snca protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCA-27341TH | Native Human SNCA | +Inquiry |
| SNCA-27345TH | Native Human SNCA | +Inquiry |
| SNCA-27339TH | Native Human SNCA | +Inquiry |
| SNCA-27342TH | Native Human SNCA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *



