Recombinant Human SNCA protein, GST-tagged
Cat.No. : | SNCA-3509H |
Product Overview : | Recombinant Human SNCA protein(P37840)(1-139AA), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-139AA |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.4 kDa |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
Gene ID | 6622 |
mRNA Refseq | NM_000345 |
Protein Refseq | NP_000336 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
SNCA-6456H | Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNCA-2744H | Recombinant Human SNCA protein(11-110 aa), C-His-tagged | +Inquiry |
SNCA-326HFL | Recombinant Full Length Human SNCA Protein, C-Flag-tagged | +Inquiry |
Snca-387R | Recombinant Rat Snca Protein | +Inquiry |
SNCA-27338TH | Recombinant Human SNCA, His-tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27341TH | Native Human SNCA | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *