Recombinant Human SNCB protein(1-134aa), His&Myc-tagged
Cat.No. : | SNCB-2879H |
Product Overview : | Recombinant Human SNCB protein(Q16143)(1-134aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-134aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA |
Gene Name | SNCB synuclein, beta [ Homo sapiens ] |
Official Symbol | SNCB |
Synonyms | SNCB; synuclein, beta; beta-synuclein; |
Gene ID | 6620 |
mRNA Refseq | NM_001001502 |
Protein Refseq | NP_001001502 |
MIM | 602569 |
UniProt ID | Q16143 |
◆ Recombinant Proteins | ||
SNCB-5298R | Recombinant Rat SNCB Protein, His (Fc)-Avi-tagged | +Inquiry |
SNCB-2056H | Recombinant Human SNCB Protein, His (Fc)-Avi-tagged | +Inquiry |
SNCB-2879H | Recombinant Human SNCB protein(1-134aa), His&Myc-tagged | +Inquiry |
SNCB-84H | Recombinant Human Synuclein, Beta | +Inquiry |
SNCB-2457M | Recombinant Mouse SNCB Protein (1-133 aa) | +Inquiry |
◆ Native Proteins | ||
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *