Recombinant Human SNCB protein(1-134aa), His&Myc-tagged
| Cat.No. : | SNCB-2879H |
| Product Overview : | Recombinant Human SNCB protein(Q16143)(1-134aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-134aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA |
| Gene Name | SNCB synuclein, beta [ Homo sapiens ] |
| Official Symbol | SNCB |
| Synonyms | SNCB; synuclein, beta; beta-synuclein; |
| Gene ID | 6620 |
| mRNA Refseq | NM_001001502 |
| Protein Refseq | NP_001001502 |
| MIM | 602569 |
| UniProt ID | Q16143 |
| ◆ Recombinant Proteins | ||
| SNCB-4366R | Recombinant Rhesus monkey SNCB Protein, His-tagged | +Inquiry |
| SNCB-6237C | Recombinant Chicken SNCB | +Inquiry |
| SNCB-11204Z | Recombinant Zebrafish SNCB | +Inquiry |
| SNCB-5006H | Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNCB-5639R | Recombinant Rat SNCB Protein | +Inquiry |
| ◆ Native Proteins | ||
| SNCB-27206TH | Native Human SNCB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
| SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *
