Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SNCB-5006H |
| Product Overview : | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SNCB synuclein beta [ Homo sapiens (human) ] |
| Official Symbol | SNCB |
| Synonyms | SNCB; synuclein, beta; beta-synuclein; |
| Gene ID | 6620 |
| mRNA Refseq | NM_003085 |
| Protein Refseq | NP_003076 |
| MIM | 602569 |
| UniProt ID | Q16143 |
| ◆ Recombinant Proteins | ||
| SNCB-2457M | Recombinant Mouse SNCB Protein (1-133 aa) | +Inquiry |
| SNCB-2879H | Recombinant Human SNCB protein(1-134aa), His&Myc-tagged | +Inquiry |
| SNCB-2056H | Recombinant Human SNCB Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNCB-246H | Recombinant Human SNCB, His-tagged | +Inquiry |
| SNCB-1294HFL | Recombinant Full Length Human SNCB Protein, C-Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCB-27206TH | Native Human SNCB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
| SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *
