Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNCB-5006H
Product Overview : SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants.
Molecular Mass : 14.3 kDa
AA Sequence : MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNCB synuclein beta [ Homo sapiens (human) ]
Official Symbol SNCB
Synonyms SNCB; synuclein, beta; beta-synuclein;
Gene ID 6620
mRNA Refseq NM_003085
Protein Refseq NP_003076
MIM 602569
UniProt ID Q16143

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNCB Products

Required fields are marked with *

My Review for All SNCB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon