Recombinant Full Length Human SNCB Protein, C-Flag-tagged
Cat.No. : | SNCB-1294HFL |
Product Overview : | Recombinant Full Length Human SNCB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.1 kDa |
AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SNCB synuclein beta [ Homo sapiens (human) ] |
Official Symbol | SNCB |
Synonyms | beta-synuclein; synuclein, beta |
Gene ID | 6620 |
mRNA Refseq | NM_001001502.3 |
Protein Refseq | NP_001001502.1 |
MIM | 602569 |
UniProt ID | Q16143 |
◆ Recombinant Proteins | ||
SNCB-4366R | Recombinant Rhesus monkey SNCB Protein, His-tagged | +Inquiry |
SNCB-2879H | Recombinant Human SNCB protein(1-134aa), His&Myc-tagged | +Inquiry |
SNCB-5639R | Recombinant Rat SNCB Protein | +Inquiry |
SNCB-1294HFL | Recombinant Full Length Human SNCB Protein, C-Flag-tagged | +Inquiry |
Sncb-249M | Recombinant Mouse Sncb Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *