Recombinant Human SNCG protein(11-120 aa), C-His-tagged
Cat.No. : | SNCG-2488H |
Product Overview : | Recombinant Human SNCG protein(O76070)(11-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-120 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE |
Gene Name | SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ] |
Official Symbol | SNCG |
Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein; |
Gene ID | 6623 |
mRNA Refseq | NM_003087 |
Protein Refseq | NP_003078 |
MIM | 602998 |
UniProt ID | O76070 |
◆ Recombinant Proteins | ||
SNCG-950C | Recombinant Cynomolgus SNCG Protein, His-tagged | +Inquiry |
SNCG-5640R | Recombinant Rat SNCG Protein | +Inquiry |
SNCG-693C | Recombinant Cynomolgus Monkey SNCG Protein, His (Fc)-Avi-tagged | +Inquiry |
Sncg-4565R | Recombinant Rat Sncg protein, His-tagged | +Inquiry |
Sncg-230M | Recombinant Mouse Sncg Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *
0
Inquiry Basket