Recombinant Human SNCG protein(11-120 aa), C-His-tagged
| Cat.No. : | SNCG-2488H |
| Product Overview : | Recombinant Human SNCG protein(O76070)(11-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-120 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE |
| Gene Name | SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ] |
| Official Symbol | SNCG |
| Synonyms | SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein; |
| Gene ID | 6623 |
| mRNA Refseq | NM_003087 |
| Protein Refseq | NP_003078 |
| MIM | 602998 |
| UniProt ID | O76070 |
| ◆ Recombinant Proteins | ||
| SNCG-2840H | Recombinant Human SNCG protein, GST-tagged | +Inquiry |
| SNCG-6326H | Recombinant Human SNCG Protein (Met1-Asp127) | +Inquiry |
| Sncg-5646R | Recombinant Rat Sncg protein, His & T7-tagged | +Inquiry |
| SNCG-3510H | Recombinant Human SNCG protein, His-SUMO-tagged | +Inquiry |
| SNCG-134H | Recombinant Human SNCG | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCG Products
Required fields are marked with *
My Review for All SNCG Products
Required fields are marked with *
