Recombinant Human SNU13 Protein (2-128 aa), His-tagged
Cat.No. : | SNU13-1476H |
Product Overview : | Recombinant Human SNU13 Protein (2-128 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-128 aa |
Description : | Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assbly. The protein undergoes a conformational change upon RNA-binding. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.0 kDa |
AA Sequence : | TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | SNU13 small nuclear ribonucleoprotein 13 [ Homo sapiens (human) ] |
Official Symbol | SNU13 |
Synonyms | FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5; |
Gene ID | 4809 |
mRNA Refseq | NM_001003796 |
Protein Refseq | NP_001003796 |
UniProt ID | P55769 |
◆ Recombinant Proteins | ||
SNU13-1476H | Recombinant Human SNU13 Protein (2-128 aa), His-tagged | +Inquiry |
SNU13-2246H | Recombinant Human SNU13 Protein, MYC/DDK-tagged | +Inquiry |
SNU13-5334H | Recombinant Human SNU13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snu13-6017M | Recombinant Mouse Snu13 Protein, Myc/DDK-tagged | +Inquiry |
SNU13-3740H | Recombinant Human SNU13 Protein (Met1-Val128), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNU13 Products
Required fields are marked with *
My Review for All SNU13 Products
Required fields are marked with *