Recombinant Human SNU13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNU13-4096H
Product Overview : NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003796) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 14.2 kDa
AA Sequence : MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNU13 small nuclear ribonucleoprotein 13 [ Homo sapiens (human) ]
Official Symbol SNU13
Synonyms SNU13; small nuclear ribonucleoprotein 13; FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5; NHP2-like protein 1; NHP2 non-histone chromosome protein 2-like 1; SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5); U4/U6.U5 tri-snRNP 15.5 kDa protein; [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein; high mobility group-like nuclear protein 2 homolog 1; non-histone chromosome protein 2-like 1; sperm specific antigen 1
Gene ID 4809
mRNA Refseq NM_001003796
Protein Refseq NP_001003796
MIM 601304
UniProt ID P55769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNU13 Products

Required fields are marked with *

My Review for All SNU13 Products

Required fields are marked with *

0
cart-icon
0
compare icon