Recombinant Human SNX1 protein, His-tagged
Cat.No. : | SNX1-800H |
Product Overview : | Recombinant Human SNX1 protein(NP_001229862)(81-287 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-287 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNX1 sorting nexin 1 [ Homo sapiens ] |
Official Symbol | SNX1 |
Synonyms | SNX1; sorting nexin 1; sorting nexin-1; HsT17379; MGC8664; SNX1A; Vps5; sorting nexin 1A; VPS5; |
Gene ID | 6642 |
mRNA Refseq | NM_001242933 |
Protein Refseq | NP_001229862 |
MIM | 601272 |
UniProt ID | Q13596 |
◆ Recombinant Proteins | ||
SNX1-696C | Recombinant Cynomolgus Monkey SNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX1-3623H | Recombinant Human SNX1 protein, GST-tagged | +Inquiry |
SNX1-30609TH | Recombinant Human SNX1, His-tagged | +Inquiry |
SNX1-2309H | Recombinant Human SNX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snx1-6019M | Recombinant Mouse Snx1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX1-1605HCL | Recombinant Human SNX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX1 Products
Required fields are marked with *
My Review for All SNX1 Products
Required fields are marked with *