Recombinant Human SNX10 protein, GST-tagged
Cat.No. : | SNX10-301313H |
Product Overview : | Recombinant Human SNX10 (124-201 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His124-Ser201 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SNX10 sorting nexin 10 [ Homo sapiens ] |
Official Symbol | SNX10 |
Synonyms | SNX10; sorting nexin 10; sorting nexin-10; MGC33054; |
Gene ID | 29887 |
mRNA Refseq | NM_001199835 |
Protein Refseq | NP_001186764 |
MIM | 614780 |
UniProt ID | Q9Y5X0 |
◆ Recombinant Proteins | ||
SNX10-3892H | Recombinant Human SNX10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNX10-2670C | Recombinant Chicken SNX10 | +Inquiry |
Snx10-6020M | Recombinant Mouse Snx10 Protein, Myc/DDK-tagged | +Inquiry |
SNX10-4203R | Recombinant Rhesus Macaque SNX10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX10-4387R | Recombinant Rhesus monkey SNX10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX10-1604HCL | Recombinant Human SNX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX10 Products
Required fields are marked with *
My Review for All SNX10 Products
Required fields are marked with *
0
Inquiry Basket