Recombinant Human SNX10 protein, GST-tagged
Cat.No. : | SNX10-301313H |
Product Overview : | Recombinant Human SNX10 protein(124-201 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 124-201 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNX10 sorting nexin 10 [ Homo sapiens ] |
Official Symbol | SNX10 |
Synonyms | SNX10; sorting nexin 10; sorting nexin-10; MGC33054; |
Gene ID | 29887 |
mRNA Refseq | NM_001199835 |
Protein Refseq | NP_001186764 |
UniProt ID | Q9Y5X0 |
◆ Recombinant Proteins | ||
SNX10-3892H | Recombinant Human SNX10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snx10-6020M | Recombinant Mouse Snx10 Protein, Myc/DDK-tagged | +Inquiry |
SNX10-4387R | Recombinant Rhesus monkey SNX10 Protein, His-tagged | +Inquiry |
SNX10-4203R | Recombinant Rhesus Macaque SNX10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX10-2670C | Recombinant Chicken SNX10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX10-1604HCL | Recombinant Human SNX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX10 Products
Required fields are marked with *
My Review for All SNX10 Products
Required fields are marked with *